This product is native myoglobin isolated from equine heart and is probably a mixture of oxidized myoglobin (metmyoglobin, Fe3+) and reduced myoglobin (Fe2+). The percentages of oxidized or reduced myoglobin in the product are not determined.
M1882
Myoglobin from equine heart
≥90% (SDS-PAGE), essentially salt-free, lyophilized powder
Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion
Synonyma:
Myoglobin from horse heart
Přihlásit pro zobrazení organizačních a smluvních cen.
Vybrat velikost
Změnit zobrazení
| Velikost balení | Skladová položka | Dostupnost | Cena |
|---|---|---|---|
| 250 mg | Obraťte se na zákaznický servis a vyžádejte si informaci o dostupnosti. | 2 830,00 Kč | |
| 1 g | Obraťte se na zákaznický servis a vyžádejte si informaci o dostupnosti. | 9 270,00 Kč | |
| 5 g | Obraťte se na zákaznický servis a vyžádejte si informaci o dostupnosti. | 36 600,00 Kč | |
| 10 g | Obraťte se na zákaznický servis a vyžádejte si informaci o dostupnosti. | 64 200,00 Kč |
O této položce
Form:
essentially salt-free, lyophilized powder
Assay:
≥90% (SDS-PAGE)
Biological source:
equine heart
2 830,00 Kč
Obraťte se na zákaznický servis a vyžádejte si informaci o dostupnosti.
Technický servis
Potřebujete pomoc? Náš tým zkušených odborníků je vám k dispozici.
Dovolte nám, abychom vám pomohlibiological source
equine heart
Quality Level
assay
≥90% (SDS-PAGE)
form
essentially salt-free, lyophilized powder
Iron content
≥0.20%
technique(s)
MALDI-MS: suitable
UniProt accession no.
storage temp.
−20°C
Gene Information
horse ... MB(100054434)
Application
Myoglobin from equine heart is suitable for use in:
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]
Biochem/physiol Actions
Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]
1 of 1
Tato položka | |||
|---|---|---|---|
| assay ≥90% (SDS-PAGE) | assay 95-100% | assay ≥95% (SDS-PAGE), ≥95% based on Mol. Wt. 12,384 basis | assay - |
| technique(s) MALDI-MS: suitable | technique(s) mass spectrometry (MS): suitable | technique(s) cell culture | mammalian: suitable | technique(s) - |
| biological source equine heart | biological source equine skeletal muscle | biological source horse heart | biological source bovine heart |
| form essentially salt-free, lyophilized powder | form essentially salt-free, lyophilized powder | form powder | form powder |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. - |
| Gene Information horse ... MB(100054434) | Gene Information horse ... MB(100054434) | Gene Information horse ... CYCS(100053958) | Gene Information - |
Still not finding the right product?
Explore all of our products under Myoglobin from equine heart
Skladovací třída
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Vyberte jednu z posledních verzí:
Již tento produkt vlastníte?
Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.
Sortimentní položky
Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Guadalupe Gómez-Baena et al.
Scientific reports, 9(1), 10757-10757 (2019-07-26)
Major urinary proteins (MUP) are the major component of the urinary protein fraction in house mice (Mus spp.) and rats (Rattus spp.). The structure, polymorphism and functions of these lipocalins have been well described in the western European house mouse
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
Globální číslo obchodní položky
| Skladová položka | GTIN |
|---|---|
| M1882-1MG | 04061823206808 |
| M1882-1G | 04061834041306 |
| M1882-10G | 04061834041290 |
| M1882-5G | 04061833630723 |
| M1882-250MG | 04061834041313 |
-
I would like to consult you about the valence state of the ion in MB. Is it 2+ or 3+?
1 answer-
Helpful?
-
-
Was this product recombinantly expressed or was it isolated directly from the heart of the horse ?
1 answer-
This product is native myoglobin isolated from equine heart.
Helpful?
-
-
Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?
1 answer-
This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
1 answer-
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, oxidized?
1 answer-
Yes, it is oxidized.
Helpful?
-
-
Do you have the sequence for Product M1882, Myoglobin from equine heart?
1 answer-
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
Helpful?
-
-
Which has more affinity for oxygen, hemoglobin or myoglobin?
1 answer-
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
What is the molecular weight of Product M1882, Myoglobin from equine heart?
1 answer-
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
-