This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
M1882
Myoglobin from equine heart
Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion
≥90% (SDS-PAGE), essentially salt-free, lyophilized powder
Synonim(y):
Myoglobin from horse heart
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wybierz wielkość
250 MG
480,00 zł
1 G
1830,00 zł
5 G
6180,00 zł
10 G
8470,00 zł
480,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Poproś o zamówienie zbiorcze
Wybierz wielkość
Zmień widok
250 MG
480,00 zł
1 G
1830,00 zł
5 G
6180,00 zł
10 G
8470,00 zł
About This Item
480,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Poproś o zamówienie zbiorcze
Polecane produkty
pochodzenie biologiczne
equine heart
Próba
≥90% (SDS-PAGE)
Formularz
essentially salt-free, lyophilized powder
Zawartość żelaza
≥0.20%
metody
MALDI-MS: suitable
numer dostępu UniProt
temp. przechowywania
−20°C
informacje o genach
horse ... MB(100054434)
Szukasz podobnych produktów? Odwiedź Przewodnik dotyczący porównywania produktów
Zastosowanie
Myoglobin from equine heart is suitable for use in:
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]
Działania biochem./fizjol.
Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]
Ta strona może zawierać tekst przetłumaczony maszynowo.
Zastosowanie
Numer produktu
Opis
Cennik
Kod klasy składowania
11 - Combustible Solids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, type N95 (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Klienci oglądali również te produkty
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
V Kery et al.
The Journal of biological chemistry, 269(41), 25283-25288 (1994-10-14)
The first committed step of transsulfuration is catalyzed by cystathionine beta-synthase (CBS), a known pyridoxal 5'-phosphate (PLP) enzyme. The inferred amino acid sequences of rat liver CBS and rat liver hemoprotein H-450 are identical. We now confirm the presence of
Computer-controlled perifusion system for neuroendocrine tissues: development and applications.
A Negro-Vilar et al.
Methods in enzymology, 124, 67-79 (1986-01-01)
Produkty
Zestaw do szybkiego trawienia trypsyną zapewnia wiarygodne wyniki analizy spektrometrii masowej w czasie krótszym niż 2 godziny.
Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.
Chromatograms
application for HPLC-
Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?
1 answer-
Helpful?
-
-
Do you have the sequence for Product M1882, Myoglobin from equine heart?
1 answer-
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, oxidized?
1 answer-
Yes, it is oxidized.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
1 answer-
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
-
-
Which has more affinity for oxygen, hemoglobin or myoglobin?
1 answer-
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
-
-
What is the molecular weight of Product M1882, Myoglobin from equine heart?
1 answer-
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
-
Active Filters
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej
