Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

AV32404

Sigma-Aldrich

Anti-LEF1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Lef1 Antibody, Lef1 Antibody - Anti-LEF1 (AB1) antibody produced in rabbit, Anti-Lymphoid enhancer-binding factor 1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

44 kDa

reaktywność gatunkowa

human, dog, bovine, goat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001124185

numer dostępu UniProt

Q9UJU2

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... LEF1(51176)

Opis ogólny

LEF1 is a transcription factor that interacts with β-catenin and modulates cell adhesion. This transcription factor also mediates nuclear responses via the Wnt signaling pathway.
Rabbit Anti-LEF1 (AB1) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.

Immunogen

Synthetic peptide directed towards the middle region of human LEF1

Zastosowanie

Rabbit Anti-LEF1 (AB1) antibody can be used for IHC (4-8μg/ml) and western blot (0.1-2.0μg/ml) applications.

Działania biochem./fizjol.

Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1).

Sekwencja

Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

J Behrens et al.
Nature, 382(6592), 638-642 (1996-08-15)
The cytoplasmic proteins beta-catenin of vertebrates and armadillo of Drosophila have two functions: they link the cadherin cell-adhesion molecules to the cytoskeleton, and they participate in the wnt/wingless signal pathway. Here we show, in a yeast two-hybrid screen, that the
Q Eastman et al.
Current opinion in cell biology, 11(2), 233-240 (1999-04-21)
LEF-1/TCF transcription factors mediate a nuclear response to Wnt signals by interacting with beta-catenin. Wnt signaling and other cellular events that increase the stability of beta-catenin result in transcriptional activation by LEF-1/TCF proteins in association with beta-catenin. In the absence
Patience Meo Burt et al.
Endocrinology, 159(6), 2386-2396 (2018-05-03)
Although humans with X-linked hypophosphatemia (XLH) and the Hyp mouse, a murine homolog of XLH, are known to develop degenerative joint disease, the exact mechanism that drives the osteoarthritis (OA) phenotype remains unclear. Mice that overexpress high-molecular-weight fibroblast growth factor

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej