AV31085

Anti-ELF1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-E74-like factor 1 (ets domain transcription factor)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 2

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 67 kDa
• species reactivity: rat, bovine, dog, human, guinea pig, rabbit, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_758961
• UniProt accession no.: P32519
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ELF1(1997)

Opis

General description

ELF1 is known to function as a transcription factor that regulates the Tie2 gene during blood vessel development. Elf1 has also been implicated in the regulation of terminal transferase gene.
Rabbit Anti-ELF1 (AB2) antibody recognizes rat, human, bovine, canine, and mouse ELF1.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELF1

Application

Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1μg/ml) applications.

Biochem/physiol Actions

ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable