Przejdź do
HPA028407
Anti-PAH antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-OTTHUMG00000007911, Anti-PH, Anti-phenylalanine hydroxylase
Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.
Wybierz wielkość
Zmień widok
| Gabaryty przesyłki | SKU | Dostępność | Cena netto |
|---|---|---|---|
| 100 μL | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2190,00 zł |
Informacje o tej pozycji
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
5
2190,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB2751
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomócbiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500-1:1000, western blot: 0.04-0.4 μg/mL
immunogen sequence
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PAH(5053)
General description
Phenylalanine hydroxylase (PAH) gene spanning 90100 kb, with 13 exons, is mapped to human chromosome 12q23.2. The gene codes for non-heme iron enzyme, phenylalanine hydroxylase that belongs to the pteridine-dependent aromatic amino acid monooxygenase family.
Immunogen
phenylalanine hydroxylase recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Phenylalanine hydroxylase (PAH) catalyzes the hydroxylation of phenylalanine to tyrosine in the presence of molecular oxygen and cofactor tetrahydrobiopterin (BH4). Mutation in the gene leads to the development of phenylketonuria (PKU) and hyperphenylalaninemia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST83043
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
1 of 1
Ta pozycja | |||
|---|---|---|---|
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
Still not finding the right product?
Klasa składowania
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Crystal structure of the ternary complex of the catalytic domain of human phenylalanine hydroxylase with tetrahydrobiopterin and 3-(2-thienyl)-L-alanine, and its implications for the mechanism of catalysis and substrate activation
Andersen OA, et al.
Journal of Molecular Biology, 320(5), 1095-1108 (2002)
Normal values and age-dependent changes in GTP cyclohydrolase I activity in stimulated mononuclear blood cells measured by high-performance liquid chromatography
Hibiya M, et al.
Journal of Chromatography. B, Biomedical Sciences and Applications, 740(1), 35-42 (2000)
A novel variant in the PAH gene causing phenylketonuria in an iranian pedigree
Alavinejad E, et al.
Avicenna Journal of Medical Biotechnology, 9(3), 146-146 (2017)
Numer pozycji handlu globalnego
| SKU | NUMER GTIN |
|---|---|
| HPA028407-100UL | 04061836278571 |
| HPA028407-25UL | 04061842950119 |