Przejdź do
HPA021844
Anti-LRSAM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
Synonim(y):
Anti-E3 ubiquitin-protein ligase LRSAM1, Anti-Leucine-rich repeat and sterile alpha motif-containing protein 1, Anti-Tsg101-associated ligase, Anti-hTAL
Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.
Wybierz wielkość
Zmień widok
| Gabaryty przesyłki | SKU | Dostępność | Cena netto |
|---|---|---|---|
| 100 μL | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2400,00 zł |
Informacje o tej pozycji
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
4
2400,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomócbiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
REILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILR
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LRSAM1(90678)
General description
LRSAM1 (leucine-rich repeat and sterile a motif-containing protein 1) is a chromosome 9q33.3 located gene consisting of a leucine-rich repeat (LRR), an ezrin-radixin-moezin (ERM) domain, a coiled-coil (CC) region, a SAM (sterile a motif) domain and a carboxyl-terminal C3HC4-type RING (really interesting new gene) finger domain.
Immunogen
E3 ubiquitin-protein ligase LRSAM1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
LRSAM1 (leucine-rich repeat and sterile a motif-containing protein 1) is an E3 type ubiquitin ligase involved in membrane vesicle fusion during viral maturation and neuronal adhesion during muscle control activity. It binds to Tsg101 (tumor susceptibility gene 101) to ubiquitinate it, which further inactivates Tsg101-mediated sorting of endocytic (epidermal growth factor receptors) and exocytic (viral proteins) cargoes.[1] It also protects cytoplasm from invasive pathogens by participating in ubiquitination associated with intracellular bacteria. Mutations in LRSAM1 cause Charcot-Marie-Tooth (CMT) disease.[1]
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST75321
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
1 of 1
Ta pozycja | |||
|---|---|---|---|
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| Quality Level 100 | Quality Level 100 | Quality Level - | Quality Level 100 |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies |
| technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200, immunofluorescence: 0.25-2 μg/mL | technique(s) immunohistochemistry: 1:20-1:50, western blot: 0.04-0.4 μg/mL | technique(s) ELISA: suitable, western blot: suitable | technique(s) immunohistochemistry: 1:50- 1:200 |
Still not finding the right product?
Klasa składowania
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Duane L Guernsey et al.
PLoS genetics, 6(8), doi:10-doi:10 (2010-09-25)
Charcot-Marie-Tooth disease (CMT) represents a family of related sensorimotor neuropathies. We studied a large family from a rural eastern Canadian community, with multiple individuals suffering from a condition clinically most similar to autosomal recessive axonal CMT, or AR-CMT2. Homozygosity mapping
Thalia Antoniadi et al.
BMC medical genetics, 16, 84-84 (2015-09-24)
Inherited peripheral neuropathy (IPN) is a clinically and genetically heterogeneous group of disorders with more than 90 genes associated with the different subtypes. Sequential gene screening is gradually being replaced by next generation sequencing (NGS) applications. We designed and validated
Ido Amit et al.
Genes & development, 18(14), 1737-1752 (2004-07-17)
The tumor suppressor gene 101 (tsg101) regulates vesicular trafficking processes in yeast and mammals. We report a novel protein, Tal (Tsg101-associated ligase), whose RING finger is necessary for multiple monoubiquitylation of Tsg101. Bivalent binding of Tsg101 to a tandem tetrapeptide
Numer pozycji handlu globalnego
| SKU | NUMER GTIN |
|---|---|
| HPA021844-100UL | 04061836325015 |
| HPA021844-25UL | 04061842879427 |