AV48836

Anti-METTL2B (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-FLJ11350, Anti-FLJ12760, Anti-METL, Anti-METTL2, Anti-METTL2A, Anti-Methyltransferase like 2B, Anti-PSENIP1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 43 kDa
• species reactivity: horse, human, pig, bovine, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060866
• UniProt accession no.: Q6P1Q9
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... METTL2B(55798)

Opis

General description

METTL2B codes for methyltransferase like 2B that is involved in tRNA methylation.
Rabbit Anti-METTL2B antibody recognizes human, mouse, rat, canine, zebrafish, and bovine METTL2B.

Immunogen

Synthetic peptide directed towards the N terminal region of human METTL2B

Application

Rabbit Anti-METTL2B antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Biochem/physiol Actions

METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable