AV35724

Anti-TRIP13 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Thyroid hormone receptor interactor 13
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 1

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 49 kDa
• species reactivity: horse, human, rabbit, bovine, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_004228
• UniProt accession no.: Q15645
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TRIP13(9319)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human TRIP13

Biochem/physiol Actions

TRIP13 protein is a hormone-dependent transcription factor. It interacts with the ligand-binding domain of thyroid hormone receptors.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable