Przejdź do zawartości
Merck

AV33859

Sigma-Aldrich

Anti-CPA1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Carboxypeptidase A1 (pancreatic)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

47 kDa

reaktywność gatunkowa

horse, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... CPA1(1357)

Immunogen

Synthetic peptide directed towards the N terminal region of human CPA1

Zastosowanie

Anti-CPA1 antibody produced in rabbit is suitable for western blot analysis.

Działania biochem./fizjol.

CPA1 (Carboxypeptidase A1) is a zinc metalloenzyme belonging to the tetragonal space group P4(3)2(1)2. It forms a multiprotein complex, Zn2+-poly(acrylic acid), by directly interacting with proteases in the gastrointestinal tract. It stimulates the hydrolytic separation of carboxyl-terminal aromatic or branched aliphatic side chain of amide bonds from peptides and proteins.

Sekwencja

Synthetic peptide located within the following region: QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Irantzu Pallarès et al.
Acta crystallographica. Section D, Biological crystallography, D64(Pt 7), 784-791 (2008-06-21)
Carboxypeptidase A1 has been the subject of extensive research in the last 30 y and is one of the most widely studied zinc metalloenzymes. However, the three-dimensional structure of the human form of the enzyme is not yet available. This
E Clauser et al.
The Journal of biological chemistry, 263(33), 17837-17845 (1988-11-25)
Nucleotide sequencing of a rat carboxypeptidase B (CPB) cDNA and direct sequencing of the CPB mRNA via primer extension on pancreatic polyadenylated RNA has yielded the complete amino acid sequence of rat CPB. The rat enzyme is synthesized as a

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej