The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
https://www.uniprot.org/uniprotkb/P01133/entry
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
E9644
Epidermal Growth Factor, human
≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Sinonimo/i:
Fattore di crescita epidermico, EGF
Autenticati per visualizzare i prezzi organizzativi e contrattuali.
Scegli un formato
Cambia visualizzazione
| Taglio della confezione | SKU | Disponibilità | Prezzo |
|---|---|---|---|
| 0.2 mg | Per conoscere la disponibilità, visualizza il carrello | CHF 328.00 | |
| 0.5 mg | Per conoscere la disponibilità, visualizza il carrello | CHF 505.00 | |
| 5 x 0.2 mg | Per conoscere la disponibilità, visualizza il carrello | CHF 739.00 |
Informazioni su questo articolo
Biological source:
human
Recombinant:
expressed in E. coli
Assay:
≥97% (SDS-PAGE)
Form:
lyophilized powder
Mol wt:
~6 kDa
Impurities:
≤1 EU/μg endotoxin (EGF)
CHF 328.00
Per conoscere la disponibilità, visualizza il carrello
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartiNome del prodotto
hEGF, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
biological source
human
Quality Segment
recombinant
expressed in E. coli
assay
≥97% (SDS-PAGE)
form
lyophilized powder
potency
0.08-0.8 ng/mL ED50/EC50
mol wt
~6 kDa
packaging
pkg of 5X0.2 mg, pkg of 0.2 mg, pkg of 0.5 mg
storage condition
avoid repeated freeze/thaw cycles
technique(s)
cell culture | mammalian: suitable
impurities
≤1 EU/μg endotoxin (EGF)
color
white
solubility
water: soluble, clear, colorless
UniProt accession no.
storage temp.
−20°C
SMILES string
S(CC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]%12N(CCC%12)C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N
InChI
1S/C270H401N73O83S7/c1-24-134(19)217(262(420)293-112-201(355)298-161(69-74-205(359)360)229(387)301-160(45-35-82-286-269(279)280)228(386)333-192(119-428)255(413)307-162(68-73-198(274)352)230(388)316-176(94-141-54-64-150(350)65-55-141)241(399)304-159(44-34-
InChI key
GVUGOAYIVIDWIO-UFWWTJHBSA-N
Gene Information
human ... EGF(1950)
Application
Biochem/physiol Actions
Il fattore di crescita epidermico (EGF) è un piccolo polipeptide mitogeno presente in un gran numero di tessuti e liquidi corporei in molte specie di mammiferi. L′EGF appartiene a una famiglia di fattori di crescita caratterizzati da 6 residui conservati di cisteina che formano tre ponti disolfuro. L′EGF è mitogeno per una serie di cellule epidermiche ed epiteliali, inclusi fibroblasti, cellule gliali, cellule dell′endotelio vascolare e corneale, cellule della granulosa bovina, cellule HeLa, SV40-3T3 e cellule epiteliali mammarie.
Funzioni cellulari su cui agisce l′EGF: mitosi, flusso ionico, trasporto del glucosio, glicolisi, sintesi degli acidi nucleici e delle proteine, sopravvivenza, crescita, proliferazione e differenziazione.
Effetti biologici dell′EGF: inibizione della secrezione acida gastrica, accrescimento e sviluppo fetale e neuromodulazione nel sistema nervoso centrale.
Vie su cui agisce l′EGF: Trasmissione del segnale EGFR, cascata MAPK, PIP, segnalazione Ca+2
Funzioni cellulari su cui agisce l′EGF: mitosi, flusso ionico, trasporto del glucosio, glicolisi, sintesi degli acidi nucleici e delle proteine, sopravvivenza, crescita, proliferazione e differenziazione.
Effetti biologici dell′EGF: inibizione della secrezione acida gastrica, accrescimento e sviluppo fetale e neuromodulazione nel sistema nervoso centrale.
Vie su cui agisce l′EGF: Trasmissione del segnale EGFR, cascata MAPK, PIP, segnalazione Ca+2
Preparation Note
Questo prodotto è stato liofilizzato da una soluzione di tampone fosfato salino a p 7,4, filtrata a 0,2 μm. Deve essere ricostituita aggiungendo il contenuto del flaconcino a 1 mg/mL con acido acetico 10 mM. Per diluire a concentrazioni inferiori, ma non al di sotto di 10 μg/mL, sarà necessaria l′aggiunta di BSA o HSA 0,1%. Per l′uso in saggi di proliferazione, diluire ulteriormente il campione con un terreno privo di albumina.
Analysis Note
L′attività biologica di questo prodotto viene misurata in un saggio di proliferazione usando cellule BALB/MK. La EC50 è definita come la concentrazione efficace del fattore di crescita che induce un incremento del 50% nella crescita cellulare in una saggio basato su cellule.
Other Notes
L′EGF umano (hEGF) è una molecola identica a β-urogastrone, una molecola isolata sulla base della sua capacità di inibire la secrezione acida gastrica. L′EGF è strutturalmente omologo al fattore di crescita trasformante umano-α, ed entrambi esercitano le loro azioni attraverso i recettori EGF. E9644 è la forma metionil N-terminale dell′EGF maturo naturale.
Disclaimer
Questo prodotto deve essere conservato a -20 °C perché si mantenga attivo per due anni. Dopo la ricostituzione può essere conservato a 2-8 °C per un mese o congelato in frazioni a -70 °C o a -20 °C per periodi più lunghi.
1 of 1
Questo articolo | |||
|---|---|---|---|
| technique(s) cell culture | mammalian: suitable | technique(s) cell culture | mammalian: suitable | technique(s) cell culture | mammalian: suitable | technique(s) cell culture | mammalian: suitable |
| assay ≥97% (SDS-PAGE) | assay ≥98% (HPLC), ≥98% (SDS-PAGE) | assay - | assay ≥95% (SDS-PAGE) |
| biological source human | biological source human | biological source mouse submaxillary glands | biological source human |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant - | recombinant expressed in NSO cells |
| Quality Level 300 | Quality Level - | Quality Level 200 | Quality Level 200 |
| form lyophilized powder | form lyophilized | form lyophilized powder | form lyophilized powder |
Classe di stoccaggio
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Protocolli
A stem cell culture protocol to generate 3D NSC models of Alzheimer’s disease using ReNcell human neural stem cell lines.
Step-by-step culture protocols for neural stem cell culture including NSC isolation, expansion, differentiation and characterization.
Articoli
Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com
Organoid culture products to generate tissue and stem cell derived 3D brain, intestinal, gut, lung and cancer tumor organoid models.
Human pancreatic cancer organoid biobank (PDAC organoids) with various KRAS mutations to aide in 3D cell culture and cancer research applications.
Contenuto correlato
Monitor barrier formation using colon PDOs, iPSC-derived colon organoids, Millicell® cell culture inserts, and the Millicell® ERS. 3.0.
Instructions
Numero articolo commerciale globale
| SKU | GTIN |
|---|---|
| E9644-.2MG | 04061838447111 |
| E9644-5X.2MG | 04061835568437 |
| E9644-.5MG | 04061838447128 |
-
what is the full peptide sequence of mature E9644 protein (~6kD)?
1 answer-
Helpful?
-
-
For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?
1 answer-
After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.
Helpful?
-
-
Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?
1 answer-
This product has been tested for activity using the mouse Balb/3T3 cell line. We have not tested its activity in rat cell culture, but we expect that will also work in that application.
Helpful?
-
-
Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
We recommend reconstitution with acetic acid to make sure the entire product will be solubilized. PBS can be used, but the total amount of the protein in the vial may not go into solution. It is best to make a higher concentration in acetic acid, and then dilute into PBS.
Helpful?
-
-
How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.
Helpful?
-
-
What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?
1 answer-
Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
The mature protein has a molecular weight of 6 kD.
Helpful?
-