HPA021240
Anti-KIFC3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-Kinesin-like protein KIFC3
조직 및 계약 가격을 보려면 로그인를 클릭합니다.
크기 선택
보기 변경
| 팩 크기 | SKU | 재고 정보 | 가격 (VAT 별도) |
|---|---|---|---|
| 100 μL | 구입 가능 여부는 고객센터에 문의하십시오. | €564.00 |
제품정보 (DICE 배송 시 비용 별도)
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
5
€564.00
구입 가능 여부는 고객센터에 문의하십시오.
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KIFC3(3801)
General description
The gene KIFC3 (kinesin-like protein KIFC3) is mapped to human chromosome 16q13-q21. It is widely expressed in human tissues.
Immunogen
Kinesin-like protein KIFC3 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
KIFC3 (kinesin-like protein KIFC3) is a minus end-directed motor protein. It regulates minus-end directed peroxisomal positioning. It controls epithelial cell-cell contacts by inhibiting E-cadherin degradation.[1] KIFC3 allows proper progress through cytokinesis partly via capping microtubules released from the centrosome.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73839
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
이 품목 | |||
|---|---|---|---|
| Quality Level 100 | Quality Level - | Quality Level - | Quality Level 100 |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form affinity isolated antibody |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| biological source rabbit | biological source rabbit | biological source mouse | biological source rabbit |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
Still not finding the right product?
저장 등급
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Denise Dietrich et al.
Biochimica et biophysica acta, 1833(12), 3013-3024 (2013-08-21)
The attachment of organelles to the cytoskeleton and directed organelle transport is essential for cellular morphology and function. In contrast to other cell organelles like the endoplasmic reticulum or the Golgi apparatus, peroxisomes are evenly distributed in the cytoplasm, which
Jeannette Nachbar et al.
Cell cycle (Georgetown, Tex.), 13(3), 426-433 (2013-11-28)
Kinesin-14 motor proteins play a variety of roles during metaphase and anaphase. However, it is not known whether members of this family of motors also participate in the dramatic changes in mitotic spindle organization during the transition from telophase to
Kyoko Sako-Kubota et al.
Molecular biology of the cell, 25(24), 3851-3860 (2014-09-26)
The adherens junction (AJ) plays a crucial role in maintaining cell-cell adhesion in epithelial tissues. Previous studies show that KIFC3, a minus end-directed kinesin motor, moves into AJs via microtubules that grow from clusters of CAMSAP3 (also known as Nezha)
국제 무역 품목 번호
| SKU | GTIN |
|---|---|
| HPA021240-25UL | 04061842875757 |
| HPA021240-100UL | 04061836315177 |