This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
M1882
Myoglobin aus Pferdeherz
Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion
≥90% (SDS-PAGE), essentially salt-free, lyophilized powder
Synonym(e):
Myoglobin from horse heart
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Größe auswählen
250 MG
€ 107,00
1 G
€ 409,00
5 G
€ 1.380,00
10 G
€ 2.720,00
Alle Fotos(3)
Größe auswählen
Ansicht ändern
250 MG
€ 107,00
1 G
€ 409,00
5 G
€ 1.380,00
10 G
€ 2.720,00
About This Item
Empfohlene Produkte
Biologische Quelle
equine heart
Assay
≥90% (SDS-PAGE)
Form
essentially salt-free, lyophilized powder
Eisengehalt
≥0.20%
Methode(n)
MALDI-MS: suitable
UniProt-Hinterlegungsnummer
Lagertemp.
−20°C
Angaben zum Gen
horse ... MB(100054434)
Suchen Sie nach ähnlichen Produkten? Aufrufen Leitfaden zum Produktvergleich
Anwendung
Myoglobin aus dem Herzmuskel des Pferdes ist geeignet für folgende Anwendungen:
- Spektralmessungen mit Beckman DU-50- oder Gilford 2400-Spektrophotometern[1]
- Analyse der Sekundärstruktur von Proteinen in H2O-Lösung unter Verwendung von Einzel-ATR-FT-IR-Mikroskopie (Fourier-Transformations-Infrarot-Spektroskopie mit abgeschwächter Totalreflexion)[2]
- Kalibrierung der Massenskala bei einer Konzentration von 2 pmol/μl in der Elektrospray-Massenspektromie[3]
- Studie zur Untersuchung der Online-Ablagerung von einzelnen Tröpfchen bei der MALDI-Massenspektrometrie[4]
- Studie zur Untersuchung der Proteinadsorption in Polyacrylamid-beschichteten Kapillaren aus synthetischem Quarzglas[5]
Biochem./physiol. Wirkung
Myoglobin ist ein mobiler Sauerstoffträger, der in roten Muskelzellen sowie Herzzellen entsteht. Dies geschieht als Reaktion auf erhöhten Sauerstoffbedarf bei körperlicher Anstrengung; der Sauerstoff wird vom Sarkolemm zu den Mitochondrien der Herzmuskelzellen und der roten Muskelzellen von Wirbeltieren transportiert.[6]
Anwendung
Produkt-Nr.
Beschreibung
Preisangaben
Lagerklassenschlüssel
11 - Combustible Solids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Persönliche Schutzausrüstung
Eyeshields, Gloves, type N95 (US)
Hier finden Sie alle aktuellen Versionen:
Analysenzertifikate (COA)
Lot/Batch Number
Die passende Version wird nicht angezeigt?
Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Kunden haben sich ebenfalls angesehen
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Computer-controlled perifusion system for neuroendocrine tissues: development and applications.
A Negro-Vilar et al.
Methods in enzymology, 124, 67-79 (1986-01-01)
Brandye M Smith et al.
Analytical chemistry, 74(16), 4076-4080 (2002-08-30)
The application of single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy was investigated for secondary structure analysis of 15 representative proteins in H2O solution. This is the first reported application of single-pass ATR-FT-IR for protein analysis; thus, the method
Artikel
Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.
Chromatograms
application for HPLC-
Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?
1 answer-
Helpful?
-
-
Do you have the sequence for Product M1882, Myoglobin from equine heart?
1 answer-
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, oxidized?
1 answer-
Yes, it is oxidized.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
1 answer-
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
-
-
Which has more affinity for oxygen, hemoglobin or myoglobin?
1 answer-
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
-
-
What is the molecular weight of Product M1882, Myoglobin from equine heart?
1 answer-
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
-
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.
