374090

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

liquid, Calbiochem^®

• Synonym(e): Anti-HO-1, Anti-Hsp32
• NACRES: NA.41
• UNSPSC Code: 12352203
• Clone: polyclonal
• Species reactivity: human, hamster, monkey, mouse, rat, canine
• Application: —
• Citations: 7

Eigenschaften

• biological source: rabbit
• Quality Level: 100
• antibody form: purified antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: liquid
• contains: ≤0.1% sodium azide as preservative
• species reactivity: human, hamster, monkey, mouse, rat, canine
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze, avoid repeated freeze/thaw cycles
• dilution: (Immunoblotting (1:1000, chemiluminescence); Immunoprecipitation (1:100))
• isotype: IgG
• shipped in: ambient
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HMOX1(3162)

Beschreibung

General description

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.

Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.

Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

Immunogen

Human

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (1:1000, chemiluminescence)

Immunoprecipitation (1:100)

Physical form

In PBS, 50% glycerol, pH 7.2.

Preparation Note

Following initial thaw, aliquot and freeze (-20°C).

Other Notes

Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 1