SAB1402829

Monoclonal Anti-KEL, (C-terminal) antibody produced in mouse

clone 4B10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CD238, ECE3
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 4B10, monoclonal
• Application: ELISA (c), ELISA (i)
• Citations: -

Eigenschaften

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4B10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable, indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_000420
• UniProt accession no.: P23276
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KEL(3792)

Beschreibung

General description

This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases. (provided by RefSeq)

Immunogen

KEL (NP_000411.1, 633 a.a. ~ 732 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNPSSRCQLW

Physical form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable