AV50153

Anti-PCDH15 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DFNB23, Anti-DKFZp667A1711, Anti-Protocadherin 15, Anti-RP11-449J3.2, Anti-USH1F
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 13

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 80 kDa
• species reactivity: human, guinea pig, rat, rabbit, mouse, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_149045
• UniProt accession no.: A2A3E5
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PCDH15(65217)

Beschreibung

General description

The gene Protocadherin-related 15 (PCDH15) is mapped to human chromosme 10q21.1. It is an integral membrane protein and one of the members of the cadherin superfamily that mediate calcium-dependent cell-cell adhesion.. PCDH15 transcripts can be detected in adult brain, lung, kidney, fetal retina and fetal cochlea.

Immunogen

Synthetic peptide directed towards the N terminal region of human PCDH15

Application

Anti-PCDH15 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

The expression of Protocadherin-related 15 (PCDH15) is essential for normal function of cochlea and retina. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). PCDH15 is expressed in nasal NK/T-cell lymphomas.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable