Fortfahren mit
HPA041013
Anti-ACSM3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(e):
Anti-Acyl-CoA synthase medium-chain family member 3, Anti-SA, Anti-SAH
Anmelden zur Ansicht der Organisations- und Vertragspreise.
Größe auswählen
Ansicht ändern
| Packungsgröße | SKU | Verfügbarkeit | Preis |
|---|---|---|---|
| 100 μL | Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein) | € 564,00 |
Über diesen Artikel
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
€ 564,00
Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)
Technischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhaltenbiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:50- 1:200
immunogen sequence
KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ACSM3(6296)
General description
Acyl-CoA synthetase medium chain family member 3 (ACSM3), also known as SAH (spontaneously hypertensive rat-clone A-hypertension–associated), is encoded by the gene mapped to human chromosome 16p13.11. ACSM3 is mainly expressed in kidneys.
Immunogen
acyl-CoA synthetase medium-chain family member 3 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Acyl-CoA synthetase medium chain family member 3 (ACSM3) is an acyl-CoA synthase involved in metabolism of medium chain fatty acids. Mutation in the gene is associated with hypertriglyceridemia, obesity-related hypertension and non-HDL-C levels in postmenopausal women.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST82203
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| Quality Level 100 | Quality Level - | Quality Level 100 | Quality Level 100 |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| Gene Information human ... ACSM3(6296) | Gene Information human ... ACSM3(6296) | Gene Information human ... ACSS3(79611) | Gene Information human ... ACSS3(79611) |
Still not finding the right product?
Probieren Sie unser Produkt-Auswahlhilfe, um Ihre Auswahl einzugrenzen
Lagerklasse
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Ming-Wei Lin et al.
Maturitas, 62(1), 66-71 (2008-12-26)
The purpose of the study is to evaluate the associations between polymorphisms of the human SA (SAH) gene, an acyl-CoA synthetase gene, with dyslipidemia and phenotypes of the insulin resistance syndrome in postmenopausal women. One hundred and forty-two postmenopausal women
Ralph Telgmann et al.
Journal of hypertension, 25(3), 557-564 (2007-02-07)
The SAH gene locus has recently been proposed to be involved in obesity-related hypertension in Japanese individuals. To replicate independently the initial findings in another ethnic group, we scanned the entire SAH gene in 190 Caucasian chromosomes. A total of
Naoharu Iwai et al.
Hypertension (Dallas, Tex. : 1979), 41(5), 1041-1046 (2003-03-26)
We recently reported that genetic polymorphisms of SAH, an acyl-CoA synthetase for fatty acids, might contribute to multiple risk factors, especially hypertriglyceridemia. There are at least 4 members in this SAH gene family, SAH, MACS1, MACS2, and MACS3, and these
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA041013-100UL | 04061836348656 |
| HPA041013-25UL | 04061841266396 |