LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions.
The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the C terminal region of human LGALS8
Application
Anti-LGALS8 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Gal-8 activates Rho signaling in TM cells and hence facilitates the regulation of cytoskeletal rearrangement in trabecular meshwork cells. Galectin-8 interacts with integrin and modulates its interaction with the extracellular matrix and hence inhibits cell adhesion and induces apoptosis. Additionally, it also has a role in modulating cell adhesion and cell growth.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.