Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

AV43935

Sigma-Aldrich

Anti-SLC16A8 antibody produced in rabbit

IgG fraction of antiserum

Szinonimák:

Anti-MCT3, Anti-Solute carrier family 16, member 8 (monocarboxylic acid transporter 3)

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

IgG fraction of antiserum

antitest terméktípus

primary antibodies

klón

polyclonal

Forma

buffered aqueous solution

molekulatömeg

52 kDa

faj reaktivitás

guinea pig, human

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

immunohistochemistry: suitable
western blot: suitable

NCBI elérési szám

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... SLC16A8(23539)

Immunogén

Synthetic peptide directed towards the middle region of human SLC16A8

Alkalmazás

Anti-SLC16A8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biokémiai/fiziológiai hatások

SLC16A8 (MCT3) is a proton-coupled monocarboxylate transporter that facilitates the movement of lactate across the cell membranes. Mutation in the gene for MCT3 results in altered visual function in mice and has been associated with age-related macular degeneration.

Szekvencia

Synthetic peptide located within the following region: RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

11 - Combustible Solids

WGK

WGK 2

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable


Válasszon a legfrissebb verziók közül:

Analitikai tanúsítványok (COA)

Lot/Batch Number

Nem találja a megfelelő verziót?

Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Lars G Fritsche et al.
Nature genetics, 45(4), 433-439 (2013-03-05)
Age-related macular degeneration (AMD) is a common cause of blindness in older individuals. To accelerate the understanding of AMD biology and help design new therapies, we executed a collaborative genome-wide association study, including >17,100 advanced AMD cases and >60,000 controls
H Yoon et al.
Genomics, 60(3), 366-370 (1999-09-24)
Lactate transport across cell membranes is mediated by a family of proton-coupled monocarboxylate transporters (MCTs). The retinal pigment epithelium (RPE) expresses a unique member of this family, MCT3. A portion of the human MCT3 gene was cloned by polymerase chain
Lauren L Daniele et al.
American journal of physiology. Cell physiology, 295(2), C451-C457 (2008-06-06)
To meet the high-energy demands of photoreceptor cells, the outer retina metabolizes glucose through glycolytic and oxidative pathways, resulting in large-scale production of lactate and CO(2). Mct3, a proton-coupled monocarboxylate transporter, is critically positioned to facilitate transport of lactate and
Timothy A Blenkinsop et al.
Investigative ophthalmology & visual science, 56(12), 7085-7099 (2015-11-06)
We tested what native features have been preserved with a new culture protocol for adult human RPE. We cultured RPE from adult human eyes. Standard protocols for immunohistochemistry, electron microscopy, electrophysiology, fluid transport, and ELISA were used. Confluent monolayers of

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással