This product is native myoglobin isolated from equine heart and is probably a mixture of oxidized myoglobin (metmyoglobin, Fe3+) and reduced myoglobin (Fe2+). The percentages of oxidized or reduced myoglobin in the product are not determined.
Select a Size
| Pack Size | SKU | Availability | Price |
|---|
About This Item
biological source
equine heart
Quality Level
assay
≥90% (SDS-PAGE)
form
essentially salt-free, lyophilized powder
Iron content
≥0.20%
technique(s)
MALDI-MS: suitable
UniProt accession no.
storage temp.
−20°C
Gene Information
horse ... MB(100054434)
Application
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]
Biochem/physiol Actions
1 of 1
This Item | |||
|---|---|---|---|
| assay ≥90% (SDS-PAGE) | assay 95-100% | assay ≥95% (SDS-PAGE), ≥95% based on Mol. Wt. 12,384 basis | assay - |
| technique(s) MALDI-MS: suitable | technique(s) mass spectrometry (MS): suitable | technique(s) cell culture | mammalian: suitable | technique(s) - |
| biological source equine heart | biological source equine skeletal muscle | biological source horse heart | biological source bovine heart |
| form essentially salt-free, lyophilized powder | form essentially salt-free, lyophilized powder | form powder | form powder |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. - |
| Gene Information horse ... MB(100054434) | Gene Information horse ... MB(100054434) | Gene Information horse ... CYCS(100053958) | Gene Information - |
Still not finding the right product?
Explore all of our products under Myoglobin from equine heart
Storage Class
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Global Trade Item Number
| SKU | GTIN |
|---|---|
| M1882-1MG | 04061823206808 |
| M1882-10G | 04061834041290 |
| M1882-5G | 04061833630723 |
| M1882-250MG | 04061834041313 |
| M1882-1G | 04061834041306 |
-
I would like to consult you about the valence state of the ion in MB. Is it 2+ or 3+?
1 answer-
Helpful?
-
-
Was this product recombinantly expressed or was it isolated directly from the heart of the horse ?
1 answer-
This product is native myoglobin isolated from equine heart.
Helpful?
-
-
Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?
1 answer-
This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
1 answer-
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, oxidized?
1 answer-
Yes, it is oxidized.
Helpful?
-
-
Do you have the sequence for Product M1882, Myoglobin from equine heart?
1 answer-
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
Helpful?
-
-
Which has more affinity for oxygen, hemoglobin or myoglobin?
1 answer-
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
What is the molecular weight of Product M1882, Myoglobin from equine heart?
1 answer-
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
-



