SAB1405460

Anti-ANXA5 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; WB
• klón: polyclonal
• faj reaktivitás: human
• citations: 2
• technika/technikák: indirect immunofluorescence: suitable; western blot: 1 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~35.9 kDa
• faj reaktivitás: human
• technika/technikák: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI elérési szám: NM_001154.2
• UniProt elérési szám: P08758
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... ANXA5(308)

Leírás

Általános leírás

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. (provided by RefSeq)

Immunogén

ANXA5 (NP_001145.1, 1 a.a. ~ 320 a.a) full-length human protein.

Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable