Ugrás a tartalomra
Merck
Összes fotó(7)

Fontos dokumentumok

WH0000308M1

Sigma-Aldrich

Monoclonal Anti-ANXA5 antibody produced in mouse

clone 1F4-1A5, purified immunoglobulin, buffered aqueous solution

Szinonimák:

ANX5, ENX2, PP4, annexin A5

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
NACRES:
NA.43

biológiai forrás

mouse

Minőségi szint

konjugátum

unconjugated

antitest forma

purified immunoglobulin

antitest terméktípus

primary antibodies

klón

1F4-1A5, monoclonal

Forma

buffered aqueous solution

faj reaktivitás

human

technika/technikák

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

izotípus

IgG1κ

GenBank elérési szám

UniProt elérési szám

kiszállítva

dry ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... ANXA5(308)

Általános leírás

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.
The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. (provided by RefSeq)

Immunogén

ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Alkalmazás

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.

Biokémiai/fiziológiai hatások

Annexins are a family of water-soluble proteins that bind to membranes and phospholipids in a calcium-dependent manner. They participate in several cellular functions, such as membrane fusion and cytoskeletal interaction. ANXA5 is a potent anticoagulant and serves as a voltage-gated calcium channel when bound to membrane in vitro. It is found to inhibit phospholipase A2 and protein kinase C.

Tulajdonságok és előnyök

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Egyéni védőeszköz

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Válasszon a legfrissebb verziók közül:

Analitikai tanúsítványok (COA)

Lot/Batch Number

Nem találja a megfelelő verziót?

Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Organization of the human annexin V (ANX5) gene.
Cookson BT
Genomics, 20, 463-467 (1994)
The crystal and molecular structure of human annexin V, an anticoagulant protein that binds to calcium and membranes.
Huber R
The Embo Journal, 9, 3867-3874 (1990)
Crystal and molecular structure of human annexin V after refinement. Implications for structure, membrane binding and ion channel formation of the annexin family of proteins.
Huber R
Journal of Molecular Biology, 223, 683-704 (1992)
Karen Oliva et al.
The Journal of endocrinology, 218(2), 165-178 (2013-05-28)
Gestational diabetes mellitus (GDM) is a significant risk factor for the type 2 diabetes epidemic in many populations. Maternal adipose tissue plays a central role in the pathophysiology of GDM. Thus, the aim of this study was to determine the

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással