M6574

Membrane Scaffold Protein 1D1

recombinant, expressed in E. coli

• Szinonimák: MSP1D1, MSP1T2
• UNSPSC kód: 12352202
• NACRES: NA.26

Tulajdonságok

• biológiai forrás: microbial
• Minőségi szint: 200
• rekombináns: expressed in E. coli
• leírás: N-Terminal histidine-tagged
• form: lyophilized powder
• molekulatömeg: M_w 24661.9 by amino acid sequence
• ε (extinkciós együttható): 18200 M^-1cm^-1 at 280 nm (His-tag-cleaved dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN₃)(lit.); 21000 M^-1cm^-1 at 280 nm (uncleaved His-tagged dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN₃)(lit.)
• tárolási hőmérséklet: −20°C

Leírás

Alkalmazás

For guidelines on the use of this and other MSP′s to prepare Nanodiscs, please visit our Protocols for Membrane Scaffold Proteins and Nanodisc Formation page.

Membrane Scaffold Protein 1D1 has been used as a scaffolding protein to stabilize lipid nanodiscs (NDs). It has also been used for the preparation of nanodiscs.

Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).

The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.

Biokémiai/fiziológiai hatások

Membrane scaffold protein 1D1 (MSP1D1) is derived from apolipoprotein A-I. It is an amphipathic synthetic protein, which self assembles to form nanodiscs.

Generates Nanodiscs ~9.7 nm in diameter

Fizikai tulajdonságok

Sequence:GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Fizikai forma

Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.

Jogi információk

Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois.

• 7,691,414 Membrane scaffold proteins
• 7,662,410 Membrane scaffold proteins and embedded membrane proteins
• 7,622,437 Tissue factor compositions and methods
• 7,592,008 Membrane scaffold proteins
• 7,575,763 Membrane scaffold proteins and tethered membrane proteins
• 7,083,958 Membrane scaffold proteins
• 7,048,949 Membrane scaffold proteins

Biztonsági adatok

• Piktogramok: GHS07
• Figyelmeztetés: Warning
• Figyelmeztető mondatok: H315,H319,H335
• Óvintézkedésre vonatkozó mondatok: P261 - P305 + P351 + P338
• Veszélyességi osztályok: Eye Irrit. 2 - Skin Irrit. 2 - STOT SE 3
• Célzott szervek: Respiratory system
• Tárolási osztály kódja: 11 - Combustible Solids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable