WH0010699M1

Monoclonal Anti-CORIN antibody produced in mouse

clone 5B6, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-ATC2, Anti-CRN, Anti-Lrp4, Anti-MGC119742, Anti-TMPRSS10
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 5B6, monoclonal
• form: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• GenBank elérési szám: NM_006587
• UniProt elérési szám: Q9Y5Q5
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CORIN(10699)

Leírás

Általános leírás

This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. (provided by RefSeq)

Immunogen

CORIN (NP_006578, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)