WH0003651M1

Monoclonal Anti-IPF1 antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-IDX1, Anti-IUF1, Anti-MODY4, Anti-PDX1, Anti-STF1, Anti-insulin promoter factor 1, homeodomain transcription factor
• MDL-szám: MFCD03791930
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); WB
• klón: 3F10, monoclonal
• faj reaktivitás: human
• citations: 2
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3F10, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2bλ
• GenBank elérési szám: NM_000209
• UniProt elérési szám: P52945
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... PDX1(3651)

Leírás

Általános leírás

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). (provided by RefSeq)

Immunogén

IPF1 (NP_000200, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)