Ugrás a tartalomra
Merck
Összes fotó(1)

Fontos dokumentumok

SRP4324

Sigma-Aldrich

Apo-SAA human

recombinant, expressed in E. coli, ≥98% (SDS-PAGE), ≥98% (HPLC)

Szinonimák:

Amyloid fibril protein AA, Amyloid protein A, SAA, SAA1, SAA2, Serum amyloid A protein

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez

Méret kiválasztása

50 μG
123 000,00 Ft

123 000,00 Ft


Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.

Megrendelés igénylése nagy tételben

Méret kiválasztása

Nézet módosítása
50 μG
123 000,00 Ft

About This Item

MDL-szám:
UNSPSC kód:
12352200
NACRES:
NA.32

123 000,00 Ft


Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.

Megrendelés igénylése nagy tételben

biológiai forrás

human

rekombináns

expressed in E. coli

Teszt

≥98% (HPLC)
≥98% (SDS-PAGE)

Forma

lyophilized

molekulatömeg

~11.5 kDa

kiszerelés

pkg of 50 μg

tárolási körülmény

avoid repeated freeze/thaw cycles

technika/technikák

protein expression: suitable

szennyeződések

endotoxin, tested

NCBI elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

Géninformáció

human ... SAA1(6288)

Általános leírás

Human apo-SAA is a 104 amino acid polypeptide that circulates primarily in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein. The human SAA gene codes for a 122 amino acid polypeptide, which contains an 18 amino acid N-terminal signal sequence.
Research Area: IMMUNO AND CKS
Serum amyloid A (SAA) proteins are a group of apolipoproteins produced in response to cytokines released by activated monocytes/macrophages.[1] SAA is a highly conserved acute-phase protein primarily synthesized by the liver.[2]

Alkalmazás

Apo-SAA human has been used to culture and stimulate RAW264.7 macrophages to study its effects on visfatin expression.[3]
Apo-serum amyloid A has been used to study its effect on the expression of Visfatin in macrophages.[4]

Biokémiai/fiziológiai hatások

Serum amyloid A (SAA) is an equally sensitive marker for the acute phase as C-reactive protein (CRP). It is the most sensitive non-invasive biochemical indicator for allograft rejection.[1] The function of SAA as a cytokine-like protein has been acknowledged in cell-cell communication and as a feedback mechanism in inflammatory, immunologic, neoplastic, and protective pathways. SAA plays a crucial role in the regulation and potentially the spread of the initial acute phase response.[5]
Serum amyloid A (SAA) is found normally at concentrations of 0.1μM in blood. However, its concentration increases up to 1000-fold under stress. It has been associated with several chronic inflammatory diseases, such as atherosclerosis. It is found to participate in the inflammatory response by facilitating chemotaxis, migration, and adhesion of inflammatory cells, particularly monocytes/macrophages. SAA is also found to induce the synthesis and secretion of multiple kinds of inflammatory cytokines, such as TNF-α (tumor necrosis factor-α), IL-1β (interleukin-1β), MCP-1 (monocyte chemoattractant protein-1), and Lp-PLA2 (lipoprotein-associated phospholipase A2).[4]

Fizikai forma

Sterile filtered and Lyophilized without additives.

Feloldás

Centrifuge the vial prior to opening. Avoid freeze-thaw cycles.
Reconstitute in 0.1% acetic acid to a concentration of 1 μg/ul. This solution can then be diluted into other aqueous buffers.

Tárolási osztály kódja

11 - Combustible Solids

WGK

WGK 3

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable


Válasszon a legfrissebb verziók közül:

Analitikai tanúsítványok (COA)

Lot/Batch Number

Nem találja a megfelelő verziót?

Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Serum amyloid A-a review
Sack Jr, George H
Molecular Medicine, 46-46 (2018)
Human serum amyloid A (SAA) protein: a prominent acute-phase reactant for clinical practice
Malle, EDBF and De Beer, FC
European Journal of Clinical Investigation, 26(6), 427-435 (1996)
Serum Amyloid a Promotes Visfatin Expression in Macrophages.
Wang S
BioMed Research International (2016)
Immune functions of serum amyloid A
Eklund KK, et al.
Critical Reviews in Immunology, 32(4) (2012)
Qian Yan et al.
Cellular signalling, 26(9), 1783-1791 (2014-04-08)
Serum amyloid A (SAA), a major acute-phase protein, has potent cytokine-like activities in isolated phagocytes and synovial fibroblasts. SAA-induced proinflammatory cytokine gene expression requires transcription factors such as NF-κB; however, the associated epigenetic regulatory mechanism remains unclear. Here we report

Questions

  1. What is the amino acid sequence of this recombinant SAA1 protein?

    1 answer
    1. Please see the published sequence for Apo-SAA below. This information is available by UniProtKB/Swiss-Prot under P0DJI8.2.
      SAA1_HUMAN
      MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
      WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

      Helpful?

Reviews

No rating value

Active Filters

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással