SAB5702551

Anti-ERK1/2 Antibody, clone 2Z8O1, Rabbit Monoclonal

• Szinonimák: ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK, 5594/5595
• UNSPSC kód: 12352203
• NACRES: NA.46

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• material: colorless
• klón: 2Z8O1, monoclonal
• form: liquid
• faj reaktivitás: rat, rat, human
• koncentráció: 0.25 mg/mL
• technika/technikák: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:1000 - 1:2000
• szín: colorless
• izotípus: IgG
• immunogén szekvencia: HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
• UniProt elérési szám: P27361; P28482
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... MAPK1(5594) , MAPK3(5595)

Leírás

Általános leírás

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK1/2 (P28482).

Alkalmazás

WB, IHC, IF/ICC, IP

Biztonsági adatok

• Piktogramok: GHS07,GHS09
• Figyelmeztetés: Warning
• Figyelmeztető mondatok: H317,H411
• Óvintézkedésre vonatkozó mondatok: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Veszélyességi osztályok: Aquatic Chronic 2 - Skin Sens. 1
• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3