SAB1404273

Monoclonal Anti-PTGIR, (C-terminal) antibody produced in mouse

clone 2A7, purified immunoglobulin, buffered aqueous solution

• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2A7, monoclonal
• form: buffered aqueous solution
• molekulatömeg: antigen ~36.12 kDa
• faj reaktivitás: human
• technika/technikák: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• NCBI elérési szám: NM_000960
• UniProt elérési szám: P43119
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... PTGIR(5739)

Leírás

Általános leírás

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. (provided by RefSeq)

Immunogen

PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable