Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
L7880
β-Lactoglobulin A from bovine milk
≥90% (PAGE)
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Méret kiválasztása
10 MG
34 800,00 Ft
25 MG
57 600,00 Ft
100 MG
170 000,00 Ft
250 MG
368 000,00 Ft
34 800,00 Ft
Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.
Összes fotó(2)
Méret kiválasztása
Nézet módosítása
10 MG
34 800,00 Ft
25 MG
57 600,00 Ft
100 MG
170 000,00 Ft
250 MG
368 000,00 Ft
About This Item
34 800,00 Ft
Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.
Javasolt termékek
biológiai forrás
bovine milk
Minőségi szint
Teszt
≥90% (PAGE)
Forma
powder
molekulatömeg
18,363 Da by calculation
technika/technikák
HPLC: suitable
UniProt elérési szám
tárolási hőmérséklet
2-8°C
Géninformáció
bovine ... LGB(280838)
Looking for similar products? Látogasson el ide Útmutató a termékösszehasonlításhoz
Általános leírás
A member of the lipocalin family, βLg is a small protein of 162 amino acids with a molecular mass of ∼18,400 Da, featuring an eight-stranded β-barrel (strands A-H) succeeded by a three-turn a-helix and a final β-strand (strand I) that forms part of the dimerization interface.[1]
Milk from dairy cows contains the protein β-lactoglobulin (BLG). It naturally occurs in a number of genetic variants, and the most prevalent bovine variants are known as BLG A and BLG B.[2]
Alkalmazás
β-Lactoglobulin A from bovine milk has been used:
- as a calibrant for the calibration of the TriWave device[3]
- as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)[4]
- in the purification and molecular weight measurement of protease samples[5]
β-Lactoglobulin was used in the identification of the genetic variants of κ-casein in milk by isoelectric focusing electrophoresis.[6]
Biokémiai/fiziológiai hatások
β-Lactoglobulin (β-lg) possesses heat-set gelation properties. It also exhibits antiviral, anticarcinogenic and hypocholesterolemic effects. β-lg can bind to retinol and long-chain fatty acids. It may participate in the absorption and metabolism of fatty acids.[7]
Tárolási osztály kódja
11 - Combustible Solids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, type N95 (US)
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Az ügyfelek ezeket is megtekintették
Laurette Tavel et al.
Journal of agricultural and food chemistry, 56(21), 10208-10217 (2008-10-22)
Interactions between beta-lactoglobulin (BLG) in its monomeric form and a wide range of aroma compounds were investigated by Fourier transform infrared (FT-IR) and 2D nuclear magnetic resonance (NMR) spectroscopies. A screening of the ligands was carried out by FT-IR through
Jeremy Pronchik et al.
The journal of physical chemistry. B, 112(36), 11422-11434 (2008-08-19)
We use time-dependent fluorescence Stokes shift (TDFSS) information to study the fluctuation rates of the lipocalin, beta-lactoglobulin A in the vicinity of an encapsulated coumarin 153 molecule. The system has three unique dielectric environments in which the fluorophore binds. We
An Acid Protease Produced by Monilinia fructigena in vitro and in Infected Apple Fruits, and its Possible Role in Pathogenesis
Hislop EC, et al.
Microbiology, 128(4), 799-807 (1982)
Bioactive milk proteins, peptides and lipids and other functional components derived from milk and bovine colostrum
Functional Foods, 471-511 (2011)
DNA Binding and Phosphorylation Regulate the Core Structure of the NF-kappaB p50 Transcription Factor
Vonderach M, et al.
Journal of the American Society For Mass Spectrometry, 30(1), 128-138 (2019)
-
What is the Department of Transportation shipping information for this product?
1 answer-
Helpful?
-
-
Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?
1 answer-
Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Helpful?
-
Active Filters
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással
