AV32519
Anti-FOSB antibody produced in rabbit
IgG fraction of antiserum
Szinonimák:
Anti-FBJ murine osteosarcoma viral oncogene homolog B
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Méret kiválasztása
100 μL
145 000,00 Ft
145 000,00 Ft
Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.
Összes fotó(3)
Méret kiválasztása
Nézet módosítása
100 μL
145 000,00 Ft
About This Item
UNSPSC kód:
12352203
NACRES:
NA.41
145 000,00 Ft
Az elérhetőséggel kapcsolatos kérdésekkel kérjük, forduljon Vevőszolgálatunkhoz.
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
IgG fraction of antiserum
antitest terméktípus
primary antibodies
klón
polyclonal
Forma
buffered aqueous solution
molekulatömeg
36 kDa
faj reaktivitás
human, horse, bovine
koncentráció
0.5 mg - 1 mg/mL
technika/technikák
immunohistochemistry: suitable
western blot: suitable
NCBI elérési szám
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... FOSB(2354)
Általános leírás
FOSB is a leucine zipper protein that functions as a transcriptional regulator. Studies in mice have reported that FOSB is involved in cocaine-induced behavioral responses.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Immunogén
Synthetic peptide directed towards the C terminal region of human FOSB
Alkalmazás
Rabbit Anti-FOSB antibody can be used for IHC (4-8μg/ml) and western blot (1.25μg/ml) applications.
Biokémiai/fiziológiai hatások
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Szekvencia
Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL
Fizikai forma
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
R F De Pauli et al.
Pharmacology, biochemistry, and behavior, 117, 70-78 (2013-12-21)
Chronic drug exposure and drug withdrawal induce expressive neuronal plasticity which could be considered as both functional and pathological responses. It is well established that neuronal plasticity in the limbic system plays a pivotal role in relapse as well as
N Hiroi et al.
Proceedings of the National Academy of Sciences of the United States of America, 94(19), 10397-10402 (1997-09-18)
Chronic exposure to cocaine leads to prominent, long-lasting changes in behavior that characterize a state of addiction. The striatum, including the nucleus accumbens and caudoputamen, is an important substrate for these actions. We previously have shown that long-lasting Fos-related proteins
Izabelle Dias Benfato et al.
Behavioural brain research, 417, 113630-113630 (2021-10-18)
Social isolation gained discussion momentum due to the COVID-19 pandemic. Whereas many studies address the effects of long-term social isolation in post-weaning and adolescence and for periods ranging from 4 to 12 weeks, little is known about the repercussions of
Josy Carolina C Pontes et al.
Epilepsy research, 126, 16-25 (2016-07-16)
The efficiency of most of the new antiepileptic drugs (AEDs) on clinical trials still falls short the success reported in pre-clinical studies, possibly because the validity of the animal models is insufficient to fully represent the human pathology. To improve
M C Gruda et al.
Oncogene, 12(10), 2177-2185 (1996-05-16)
FosB, one of the members of the Fos family, is rapidly induced in many cell types upon stimulation and has a stimulatory effect on the proliferation of cultured cells. To understand the tissue distribution of FosB, we have studied its
Active Filters
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással
