5100
CD164 human
recombinant, expressed in E. coli, 0.5 mg protein/mL
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(1)
About This Item
UNSPSC kód:
12352200
NACRES:
NA.75
Javasolt termékek
biológiai forrás
human
rekombináns
expressed in E. coli
leírás
0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterilitás
Filtered sterilized solution
Teszt
≥90% (SDS-PAGE)
form
liquid
kiszerelés
pkg of 50 μg
koncentráció
0.5 mg protein/mL
elérési szám
NP_006007
UniProt elérési szám
tárolási hőmérséklet
−20°C
Géninformáció
human ... CD164(8763)
Alkalmazás
Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 μg/well allows for human HSC / receptor interaction studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Szekvencia
MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Elkészítési megjegyzés
The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 2
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Benedikt Demmert et al.
Materials (Basel, Switzerland), 12(11) (2019-06-07)
Calcareous biominerals typically feature a hybrid nanogranular structure consisting of calcium carbonate nanograins coated with organic matrices. This nanogranular organisation has a beneficial effect on the functionality of these bioceramics. In this feasibility study, we successfully employed a flow-chemistry approach
Felipe Díaz-Soler et al.
Nanomaterials (Basel, Switzerland), 11(1) (2021-01-23)
In this work, calcium oxalate (CaOx) precursors were stabilized by poly(acrylic acid) (PAA) as an additive under in vitro crystallization assays involving the formation of pre-nucleation clusters of CaOx via a non-classical crystallization (NCC) pathway. The in vitro crystallization of
P T Ramos et al.
Materials science & engineering. C, Materials for biological applications, 103, 109742-109742 (2019-07-28)
This study aimed to develop nanocapsules containing ketoprofen using rose hip oil (Keto-NC) as oil core, and to evaluate their anti-inflammatory activity in acute and chronic ear edema models in mice. Physicochemical characterization, drug release, photostability and cytotoxicity assays were
Santosh Prasad Gupta et al.
Journal of physics. Condensed matter : an Institute of Physics journal, 32(19), 194004-194004 (2020-01-21)
We present studies on the structure of complexes of the cationic, bilayer-forming surfactant, didodecyldimethylammonium bromide (DDAB), and the anionic polyelectrolyte sodium polyacrylate (PAANa). In the presence of uncomplexed polyelectrolyte in the coexisting aqueous solution, these complexes are found to exhibit
Meera Thomas et al.
The Journal of chemical physics, 150(9), 094903-094903 (2019-03-10)
We report salt-induced swelling transitions of a lamellar complex of the anionic polyelectrolyte, poly(acrylic acid sodium salt) (PAANa), and the cationic amphiphile, didodecyldimethylammonium chloride (DDAC). Increasing the concentration of NaCl in the solution is found to lead to a collapsed
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással