SAB1401151

Anti-GHRH antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Szinonimák: GHRF, GRF, MGC119781
• MDL-szám: MFCD00162359
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: WB
• klón: polyclonal
• faj reaktivitás: human
• technika/technikák: western blot: 1 μg/mL

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: western blot: 1 μg/mL
• NCBI elérési szám: NM_021081
• UniProt elérési szám: P01286
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... GHRH(2691)

Leírás

Általános leírás

The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. (provided by RefSeq)

Immunogén

GHRH (NP_066567.1, 1 a.a. ~ 108 a.a) full-length human protein.

Sequence
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable