AMAB91793

Anti-TMPRSS2 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12512, purified by using Protein A, buffered aqueous glycerol solution

• Szinonimák: PRSS10
• UNSPSC kód: 12352203
• NACRES: NA.41
• klón: CL12512, monoclonal
• application: IHC
• faj reaktivitás: human
• technika/technikák: immunohistochemistry: 1:10000-1:20000

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest terméktípus: primary antibodies
• klón: CL12512, monoclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• tisztítva: using Protein A
• faj reaktivitás: human
• fejlettebb validálás: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technika/technikák: immunohistochemistry: 1:10000-1:20000
• izotípus: IgG1
• Ensembl | humán elérési szám: ENSG00000184012
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• Géninformáció: human ... TMPRSS2(7113)

Leírás

Immunogén

Transmembrane serine protease 2

Alkalmazás

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Tulajdonságok és előnyök

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Szekvencia

GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT

Kapcsolódás

Corresponding Antigen APREST87138

Fizikai forma

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Tárolás és stabilitás

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1