HPA017980

Anti-SLC3A2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-4F2, Anti-4F2HC, Anti-4T2HC, Anti-CD98, Anti-solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA017980
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• faj reaktivitás: human
• fejlettebb validálás: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• immunogén szekvencia: KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
• UniProt elérési szám: P08195
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... SLC3A2(6520)

Leírás

Általános leírás

SLC3A2 (solute carrier family 3 member 2) is an integrin associated protein expressed at high levels on proliferating lymphocytes and other rapidly growing cells. It is also known as CD98hc and 4F2hc. It belongs to the CD98 family. SLC3A2 has a common glycosylated 80 kDa heavy chain and a group of ∼45 kDa light chains. SLC3A2 is located on human chromosome 11q12.

Immunogen

solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-SLC3A2 antibody produced in rabbit has been used in western blotting.

Biokémiai/fiziológiai hatások

SLC3A2 (solute carrier family 3 member 2) promotes integrin signalling. It has the ability to modulate the activities of selected integrins (5-8). It also controls the expression and supply of the light chains to regulate amino acid transport function. Absence of CD98hc results in embryonic lethality.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST72200

Fizikai forma

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable