HPA019472
Anti-SST Antibody
rabbit polyclonal
Szinonimák:
Anti-Growth hormone release-inhibiting factor, Anti-Somatostatin
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(8)
About This Item
Javasolt termékek
product name
Anti-SST antibody produced in rabbit, affinity isolated antibody, buffered aqueous glycerol solution
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
form
buffered aqueous glycerol solution
faj reaktivitás
human
fejlettebb validálás
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technika/technikák
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL
immunogén szekvencia
APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SST(6750)
Általános leírás
SST (somatostatin) is present in two active forms SST-14 (14 amino acids length) and SST-28.
Immunogen
Somatostatin Precursor recombinant protein epitope signature tag (PrEST)
Alkalmazás
Anti-SST antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biokémiai/fiziológiai hatások
SST (somatostatin) functions by binding to the G protein-coupled receptor (somatostatin receptors). It is a peptide hormone which is produced in the hypothalamus, the gastrointestinal tract and the endocrine pancreas. SST inhibits hormone secretion and gastrointestinal function. In presence of glucose and amino acids, SST-14 is released from δ-cells in pancreatic islets of Langerhans. It suppresses the secretion of insulin and glucagon. In the gastrointestinal tract, SST suppresses gallbladder contraction and reduces secretion.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST74709
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
javasolt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Xiang-Dong Wan et al.
CNS neuroscience & therapeutics, 30(7), e14863-e14863 (2024-07-22)
Childhood sensory abnormalities experience has a crucial influence on the structure and function of the adult brain. The underlying mechanism of neurological function induced by childhood sensory abnormalities experience is still unclear. Our study was to investigate whether the GABAergic
Jennifer E Bruin et al.
Diabetes, 65(5), 1297-1309 (2016-01-08)
Pancreatic progenitors derived from human embryonic stem cells (hESCs) are a potential source of transplantable cells for treating diabetes and are currently being tested in clinical trials. Yet, how the milieu of pancreatic progenitor cells, including exposure to different factors
Jonathan Strosberg et al.
World journal of gastroenterology, 16(24), 2963-2970 (2010-06-24)
Somatostatin analogs were initially developed for the control of hormonal syndromes associated with neuroendocrine tumors (NETs). In recent years, accumulating data has supported their role as antiproliferative agents, capable of stabilizing tumor growth in patients with metastatic neuroendocrine malignancies, including
Michael B Krawchuk et al.
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism, 40(7), 1427-1440 (2019-08-17)
The impact of different neuronal populations on local cerebral blood flow (CBF) regulation is not well known and insight into these relationships could enhance the interpretation of brain function and dysfunction from brain imaging data. We investigated the role of
Balrik Kailey et al.
American journal of physiology. Endocrinology and metabolism, 303(9), E1107-E1116 (2012-08-31)
Somatostatin-14 (SST) inhibits insulin and glucagon secretion by activating G protein-coupled somatostatin receptors (SSTRs), of which five isoforms exist (SSTR1-5). In mice, the effects on pancreatic β-cells are mediated by SSTR5, whereas α-cells express SSTR2. In both cell types, SSTR
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással