Ugrás a tartalomra
Merck
Összes fotó(6)

Fontos dokumentumok

HPA014518

Sigma-Aldrich

Anti-P2RY12 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Szinonimák:

Anti-HORK3, Anti-P2Y12, Anti-SP1999

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
Human Protein Atlas-szám:
NACRES:
NA.41
konjugátum:
unconjugated
application:
IHC
klón:
polyclonal
faj reaktivitás:
human
citations:
49
technika/technikák:
immunohistochemistry: 1:1000-1:2500

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

Forma

buffered aqueous glycerol solution

faj reaktivitás

human

fejlettebb validálás

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technika/technikák

immunohistochemistry: 1:1000-1:2500

immunogén szekvencia

KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... P2RY12(64805)

Általános leírás

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) is encoded by the gene mapped to human chromosome 3q25.1. The encoded protein belongs to the family of P2 purinergic receptors. P2RY12 is characterized with seven transmembrane G protein coupled receptors (GPCRs) that contributes to ATP-and ADP-mediated cell migration in vitro. The protein is expressed in activated platelets and microglial cells.

Immunogén

purinergic receptor P2Y, G-protein coupled, 12

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Anti-P2RY12 antibody produced in rabbit has been used in immunohistochemistry.

Biokémiai/fiziológiai hatások

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) interacts with its ligand ADP and gets activated. This activated receptor plays a vital role in increasing the platelet responses that underlie arterial thrombosis and associated inflammation. P2RY12 is also involved in maintaining thrombus stability in-vivo.Mutation in the gene is associated with the development of ADP receptor deficiency and blood pressure-related disorders. Inhibition of P2RY12 is considered to be a potent therapeutic method for treating pathologic bone loss.

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST72771

Fizikai forma

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1


Válasszon a legfrissebb verziók közül:

Analitikai tanúsítványok (COA)

Lot/Batch Number

Nem találja a megfelelő verziót?

Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Az ügyfelek ezeket is megtekintették

Amanda McQuade et al.
Molecular neurodegeneration, 13(1), 67-67 (2018-12-24)
Microglia, the principle immune cells of the brain, play important roles in neuronal development, homeostatic function and neurodegenerative disease. Recent genetic studies have further highlighted the importance of microglia in neurodegeneration with the identification of disease risk polymorphisms in many
Gloriia Novikova et al.
Nature communications, 12(1), 1610-1610 (2021-03-14)
Genome-wide association studies (GWAS) have identified more than 40 loci associated with Alzheimer's disease (AD), but the causal variants, regulatory elements, genes and pathways remain largely unknown, impeding a mechanistic understanding of AD pathogenesis. Previously, we showed that AD risk
Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor.
Mildner A.
Neural Regeneration Research, 12(4), 570?571-570?571 (2017)
Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor.
Alexander Mildner
Neural regeneration research, 12(4), 570-571 (2017-05-30)
Mohammad A Rai et al.
Retrovirology, 17(1), 35-35 (2020-11-21)
HIV associated neurocognitive disorders cause significant morbidity and mortality despite the advent of highly active antiretroviral therapy. A deeper understanding of fundamental mechanisms underlying HIV infection and pathogenesis in the central nervous system is warranted. Microglia are resident myeloid cells

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással