HPA012878
Anti-NLRP3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-AGTAVPRL, Anti-AII, Anti-C1orf7, Anti-CIAS1, Anti-CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(5)
About This Item
konjugátum:
unconjugated
application:
IHC
klón:
polyclonal
faj reaktivitás:
human
citations:
18
technika/technikák:
immunohistochemistry: 1:200- 1:500
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
human
technika/technikák
immunohistochemistry: 1:200- 1:500
immunogén szekvencia
FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... NLRP3(114548)
Általános leírás
NLRP3 is a signaling protein belonging to leucine rich repeat family and regulates the apoptotic and inflammatory signaling pathways. Rabbit polyclonal anti- NLRP3 antibody can be used in western blotting. Anti- NLRP3 antibodies are specific for NLRP3 protein.
Immunogén
NACHT, LRR and PYD domains-containing protein 3 recombinant protein epitope signature tag (PrEST)
Alkalmazás
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST76150
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Válasszon a legfrissebb verziók közül:
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Az ügyfelek ezeket is megtekintették
Ravichandran Panchanathan et al.
Oncotarget, 7(19), 28183-28194 (2016-04-09)
The molecular mechanisms by which hypoxia contributes to prostatic chronic inflammation (PCI) remain largely unknown. Because hypoxia stimulates the transcriptional activity of NF-κB, which "primes" cells for inflammasome activation by inducing the expression of NLRP3 or AIM2 receptor and pro-IL-1β
Heidi Hsieh et al.
Toxicology in vitro : an international journal published in association with BIBRA, 35, 24-30 (2016-05-18)
Zinc is both an essential and potentially toxic metal. It is widely believed that oral zinc supplementation can reduce the effects of the common cold; however, there is strong clinical evidence that intranasal (IN) zinc gluconate (ZG) gel treatment for
Lei Chen et al.
Cancer immunology, immunotherapy : CII (2023-01-01)
The NOD-like receptor family pyrin domain-containing 3 (NLRP3) inflammasome plays cell- and tissue-specific roles in cancer, meaning that its activation in different tumors or cells may play different roles in tumor progression. We have previously described the tumor-promoting function of
Jeremy A Hirota et al.
American journal of respiratory cell and molecular biology, 49(4), 517-524 (2013-04-26)
Inflammasomes have emerged as playing key roles in inflammation and innate immunity. A growing body of evidence has suggested that the nucleotide-binding domain and leucine-rich repeat protein-3 (NLRP3) inflammasome is important in chronic airway diseases such as asthma and chronic
Carla Iacobini et al.
British journal of pharmacology, 175(1), 53-66 (2017-10-21)
The advanced glycation end products (AGEs) participate in the pathogenesis of diabetic nephropathy (DN) by promoting renal inflammation and injury. L-carnosine acts as a quencher of the AGE precursors reactive carbonyl species (RCS), but is rapidly inactivated by carnosinase. In
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással