AV54324
Anti-IL1B antibody produced in rabbit
affinity isolated antibody
Szinonimák:
Anti-IL-1, Anti-IL1-BETA, Anti-IL1F2, Anti-Interleukin 1, β
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(3)
About This Item
UNSPSC kód:
12352203
NACRES:
NA.41
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
Forma
buffered aqueous solution
molekulatömeg
17 kDa
faj reaktivitás
human
koncentráció
0.5 mg - 1 mg/mL
technika/technikák
immunohistochemistry: suitable
western blot: suitable
NCBI elérési szám
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... IL1B(3553)
Általános leírás
Interleukin-1β (IL1β) is produced by activated macrophages. It is synthesized as pro-IL-1β which is changed to active form IL-1β with the help of pro-inflammatory protease caspase-1. IL-1β belongs to the IL-1 gene family. It is a proinflammatory cytokine. The gene is mapped to human chromosome 2q14.
Immunogén
Synthetic peptide directed towards the N terminal region of human IL1B
Alkalmazás
Anti-IL1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biokémiai/fiziológiai hatások
Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. IL-1β has pleiotropic activities and is protective against infections by recruitment of neutrophils to the infection site, secretion of cytokines and chemokines and activation of adhesion molecules. IL-1β overproduction has been implicated in many auto-immune and allergic disorders such as Cryopirin-associated periodic syndromes, Muckle-Wells syndrome and skin lesions.
Szekvencia
Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
Fizikai forma
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Az ügyfelek ezeket is megtekintették
Manoranjan Sahoo et al.
TheScientificWorldJournal, 11, 2037-2050 (2011-11-30)
The inflammasome is an important innate immune pathway that regulates at least two host responses protective against infections: (1) secretion of the proinflammatory cytokines IL-1β and IL-18 and (2) induction of pyroptosis, a form of cell death. Inflammasomes, of which
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Emmanuel Contassot et al.
Swiss medical weekly, 142, w13590-w13590 (2012-06-02)
Interleukin 1, one of the first cytokines discovered in the 1980s, and a potent mediator of fever, pain and inflammation, is at present experiencing a revival in biology and medicine. Whereas the mechanism of activation and secretion of interleukin 1β
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással