AV41490
Anti-Fibronectin Antibody
rabbit polyclonal
Szinonimák:
Fn1 Antibody, Fn1 Antibody - Anti-FN1 antibody produced in rabbit, Anti-CIG, Anti-DKFZp686F10164, Anti-DKFZp686H0342, Anti-DKFZp686I1370, Anti-DKFZp686O13149, Anti-FINC, Anti-FN, Anti-Fibronectin 1
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(2)
About This Item
UNSPSC kód:
12352203
NACRES:
NA.41
Javasolt termékek
product name
Anti-FN1 antibody produced in rabbit, affinity isolated antibody
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
form
buffered aqueous solution
molekulatömeg
76 kDa
faj reaktivitás
bovine, dog, sheep, pig, human
koncentráció
0.5 mg - 1 mg/mL
technika/technikák
western blot: suitable
NCBI elérési szám
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... FN1(2335)
Related Categories
Általános leírás
Fibronectins are a class of immunochemically related glycoproteins present in basement membranes, collective tissues and blood wherein they mediate adhesion between matrix components and cells. Plasma fibronectin (CLG) mediates the attachment of monocytes (fibroblasts, macrophages) to various cell matrices and materials such as gelatin.
Egyediség
Anti-FN1 polyclonal antibody reacts with human, canine, rabbit, bovine, rat, and mouse plasma fibronectin (CIG).
Immunogen
Synthetic peptide directed towards the C terminal region of human FN1
Alkalmazás
Anti-FN1 polyclonal antibody is used to tag plasma fibronectin (CIG) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of fibronectin (CIG) in the adherence of monocytes to cell matricies and solid surfaces coated with materials such as gelatin.
Biokémiai/fiziológiai hatások
FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
Szekvencia
Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
Fizikai forma
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Az ügyfelek ezeket is megtekintették
Donor-But Not Recipient-Derived Cells Produce Collagen-1 in Chronically Rejected Cardiac Allografts.
Saidou Balam et al.
Frontiers in immunology, 12, 816509-816509 (2022-02-08)
Fibrosis is a prominent feature of chronic allograft rejection, caused by an excessive production of matrix proteins, including collagen-1. Several cell types produce collagen-1, including mesenchymal fibroblasts and cells of hematopoietic origin. Here, we sought to determine whether tissue-resident donor-derived
Simone Buchtler et al.
Journal of the American Society of Nephrology : JASN, 29(7), 1859-1873 (2018-05-20)
Background Interstitial fibrosis is associated with chronic renal failure. In addition to fibroblasts, bone marrow-derived cells and tubular epithelial cells have the capacity to produce collagen. However, the amount of collagen produced by each of these cell types and the
Saidou Balam et al.
Journal of immunology (Baltimore, Md. : 1950), 202(12), 3514-3523 (2019-05-10)
Chronic rejection is a major problem in transplantation medicine, largely resistant to therapy, and poorly understood. We have shown previously that basophil-derived IL-4 contributes to fibrosis and vasculopathy in a model of heart transplantation with depletion of CD4+ T cells.
Guiqin Song et al.
Oncotarget, 8(11), 17771-17784 (2017-02-02)
Esophageal cancer is a highly aggressive malignancy with very poor overall prognosis. Given the strong clinical relevance of SATB1 in esophagus cancer and other cancers suggested by previous studies, the exact function of SATB1 in esophagus cancer development is still
Yan Wang et al.
International journal of molecular medicine, 35(4), 1067-1073 (2015-02-13)
Fucoidan, an extract of the seaweed, Fucus vesiculosus, has been widely investigated for its antioxidant effects. However, to date and to the best of our knowledge, pathological studies on the effects of fucoidan against diabetic nephropathy (DN) related to spontaneous
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással