HPA027066

Anti-Fibronectin Antibody

Prestige Antibodies^® Powered by Atlas Antibodies, rabbit polyclonal

• Szinonimák: Anti-CIG, Anti-FINC, Anti-GFND2, Anti-LETS, Anti-MSF, Anti-fibronectin 1
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA027066
• NACRES: NA.41

Tulajdonságok

• product name: Anti-FN1 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• faj reaktivitás: human
• fejlettebb validálás: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• immunogén szekvencia: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
• UniProt elérési szám: P02751
• alkalmazás(ok): research pathology
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... FN1(2335)

Leírás

Általános leírás

Fibronectin 1 (FN1) is a glycoprotein of the extracellular matrix. It is encoded by the gene mapped to human chromosome 2q35. FN1 is expressed in the plasma and at the cell surface. Fibronectin is mostly synthesized by fibroblasts and endothelial cells.

Immunogen

fibronectin 1 recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-FN1 antibody produced in rabbit has been used in western blotting and immunohistochemical staining.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biokémiai/fiziológiai hatások

Fibronectin 1 (FN1) plays a vital role in cell adhesion, growth, migration, wound healing, blood coagulation and metastasis. In addition, it also facilitates cell attachment and proliferation, control of cell cytoskeleton, morphology and differentiation. FN1 is also involved in extracellular matrix formation, hemostasis and thrombosis. Mutations in FN1 lead to glomerulopathy. Fibronectin production by normal human foreskin fibroblasts has been shown to improve two-fold after glucocorticoid treatment.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST72592

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable