AV38611

Anti-MyB antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-Cmyb, Anti-Efg, Anti-c-myb, Anti-c-myb_CDS, Anti-v-Myb myeloblastosis viral oncogene homolog (avian)
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 38 kDa
• faj reaktivitás: mouse, bovine, human, horse, dog, rabbit, guinea pig, rat
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: immunohistochemistry: suitable; western blot: suitable
• NCBI elérési szám: NP_001123644
• UniProt elérési szám: P10242
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... MYB(4602)

Leírás

Immunogen

Synthetic peptide directed towards the N terminal region of human MYB

Alkalmazás

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Biokémiai/fiziológiai hatások

MYB may be a transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Szekvencia

Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 2
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable