Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

AV36678

Sigma-Aldrich

Anti-RUNX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Szinonimák:

Anti-Runt-related transcription factor 2

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(2)

About This Item

UNSPSC kód:
12352203
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

100

konjugátum

unconjugated

antitest forma

IgG fraction of antiserum

antitest terméktípus

primary antibodies

klón

polyclonal

form

buffered aqueous solution

molekulatömeg

57 kDa

faj reaktivitás

human, guinea pig, rat, mouse, bovine, rabbit, dog

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

western blot: suitable

NCBI elérési szám

NP_001019801

UniProt elérési szám

Q13950

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... RUNX2(860)

Immunogen

Synthetic peptide directed towards the middle region of human RUNX2

Biokémiai/fiziológiai hatások

RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

Szekvencia

Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 3

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Jingjing Zhao et al.
Cell transplantation, 31, 9636897221086965-9636897221086965 (2022-03-23)
Mesenchymal stem cells (MSCs) have been shown to exert a positive impact on osteonecrosis of the femoral head (ONFH) in preclinical experiments and clinical trials. After the femoral head suffers avascular necrosis, the transplanted MSCs undergo a great deal of
Fei Zhang et al.
Experimental & molecular medicine, 54(11), 1991-2006 (2022-11-16)
Bone marrow mesenchymal stem cells (BMSCs) have been used in the treatment of early steroid-induced osteonecrosis of the femoral head (SONFH). However, the hypoxic microenvironment in the osteonecrotic area leads to hypoxia-induced apoptosis of transplanted BMSCs, which limits their efficacy.
Fei Zhang et al.
Cell death & disease, 11(1), 42-42 (2020-01-22)
Survival and stemness of bone marrow mesenchymal stem cells (BMSCs) in osteonecrotic areas are especially important in the treatment of early steroid-induced osteonecrosis of the femoral head (ONFH). We had previously used BMSCs to repair early steroid-induced ONFH, but the
Jiahua Shao et al.
Stem cells international, 2021, 6624874-6624874 (2021-03-26)
To evaluate the effect of Kartogenin-pretreated exosomes derived from infrapatellar fat pad mesenchymal stem cells on chondrocyte in vitro and articular cartilage regeneration in vivo. Infrapatellar fat pad mesenchymal stem cells (IPFP-MSCs) were isolated from rabbits to harvest exosomes. After

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással