WH0010891M3
Anti-PGC-1α antibody produced in mouse
clone 1F3, purified immunoglobulin, buffered aqueous solution
Szinonimák:
Anti-LEM6, Anti-PGC1, Anti-PGC1(α), Anti-PGC1A, Anti-PGC1v, Anti-PPARGC1, Anti-Peroxisome proliferative activated receptor, γ, coactivator 1, α
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(1)
About This Item
konjugátum:
unconjugated
application:
ELISA (i)
klón:
1F3, monoclonal
faj reaktivitás:
human
citations:
4
technika/technikák:
indirect ELISA: suitable
Javasolt termékek
biológiai forrás
mouse
Minőségi szint
konjugátum
unconjugated
antitest forma
purified immunoglobulin
antitest terméktípus
primary antibodies
klón
1F3, monoclonal
Forma
buffered aqueous solution
faj reaktivitás
human
technika/technikák
indirect ELISA: suitable
izotípus
IgG2aκ
GenBank elérési szám
UniProt elérési szám
kiszállítva
dry ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... PPARGC1A(10891)
Általános leírás
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)
Immunogén
PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Biokémiai/fiziológiai hatások
Peroxisome proliferator-activated receptor γ coactivator (PGC)-1α is implicated in the modulation of the expression of mitochondrial oxidative phosphorylation (OXPHOS) genes and endogenous antioxidants. Variation in the gene expression leads to Huntington′s disease (HD) and type 2 diabetes in humans. PGC-1α functions as a ‘molecular switch′ in genetic pathways involved in maintaining glucose homeostasis in liver and muscle, β cell insulin secretion and mitochondrial biogenesis. Addition to this, PGC-1α has a crucial role to play in adaptive thermogenesis, skeletal muscle fiber type switching, and heart development. PGC-1α reduces or improves muscle dystrophy muscle dystrophy by stimulating various molecular pathways; therefore, increase in the concentration and activity of PGC-1 is considered to be a potential method for Duchenne muscular dystrophy (DMD) treatment.
Fizikai forma
Solution in phosphate buffered saline, pH 7.4
Jogi információk
GenBank is a registered trademark of United States Department of Health and Human Services
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Az ügyfelek ezeket is megtekintették
Rory P Cunningham et al.
Diabetes, 70(11), 2476-2491 (2021-08-13)
Regulation of endothelial nitric oxide synthase (eNOS) in hepatocytes may be an important target in nonalcoholic fatty liver disease (NAFLD) development and progression to nonalcoholic steatohepatitis (NASH). In this study, we show genetic deletion and viral knockdown of hepatocyte-specific eNOS
PGC-1alpha regulates the neuromuscular junction program and ameliorates Duchenne muscular dystrophy.
Christoph Handschin et al.
Genes & development, 21(7), 770-783 (2007-04-04)
The coactivator PGC-1alpha mediates key responses of skeletal muscle to motor nerve activity. We show here that neuregulin-stimulated phosphorylation of PGC-1alpha and GA-binding protein (GABP) allows recruitment of PGC-1alpha to the GABP complex and enhances transcription of a broad neuromuscular
S Soyal et al.
Diabetologia, 49(7), 1477-1488 (2006-06-06)
Data derived from several recent studies implicate peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) in the pathogenesis of type 2 diabetes. Lacking DNA binding activity itself, PGC-1alpha is a potent, versatile regulator of gene expression that co-ordinates the activation and repression of
Huiyun Liang et al.
Advances in physiology education, 30(4), 145-151 (2006-11-17)
Peroxisome proliferator-activated receptor-gamma coactivator (PGC)-1alpha is a member of a family of transcription coactivators that plays a central role in the regulation of cellular energy metabolism. It is strongly induced by cold exposure, linking this environmental stimulus to adaptive thermogenesis.
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással