WH0007852M2

Monoclonal Anti-CXCR4 antibody produced in mouse

clone 1F8, ascites fluid

• Szinonimák: Anti-CD184, Anti-D2S201E, Anti-FB22, Anti-HM89, Anti-HSY3RR, Anti-LAP3, Anti-LCR1, Anti-LESTR, Anti-NPY3R, Anti-NPYR, Anti-NPYRL, Anti-NPYY3R, Anti-WHIM, Anti-chemokine (C-X-C motif) receptor 4
• MDL-szám: MFCD01092337
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); WB
• klón: 1F8, monoclonal
• faj reaktivitás: human
• citations: 13
• technika/technikák: indirect ELISA: suitable; western blot: 1:500-1:1000

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: ascites fluid
• antitest terméktípus: primary antibodies
• klón: 1F8, monoclonal
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1:500-1:1000
• izotípus: IgG1κ
• GenBank elérési szám: BC020968
• UniProt elérési szám: P61073
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CXCR4(7852)

Leírás

Általános leírás

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogén

CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Fizikai forma

Solution

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)