SAB5702268

Anti-Perilipin-2 Antibody, clone 9W7Y9, Rabbit Monoclonal

• Szinonimák: PLIN2,ADFP,ADRP
• UNSPSC kód: 12352203
• NACRES: NA.46
• klón: 9W7Y9, monoclonal
• application: IF; IHC; WB
• faj reaktivitás: rat, human, rat
• technika/technikák: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• material: colorless
• klón: 9W7Y9, monoclonal
• Forma: liquid
• molekulatömeg: 52 kDa
• faj reaktivitás: rat, human, rat
• koncentráció: 0.91 mg/mL
• technika/technikák: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• szín: colorless
• izotípus: IgG
• immunogén szekvencia: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH
• UniProt elérési szám: Q99541
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... Perilipin-2(123)

Leírás

Általános leírás

The protein encoded by this gene belongs to the perilipin family, members of which coat intracellular lipid storage droplets. This protein is associated with the lipid globule surface membrane material, and maybe involved in development and maintenance of adipose tissue. However, it is not restricted to adipocytes as previously thought, but is found in a wide range of cultured cell lines, including fibroblasts, endothelial and epithelial cells, and tissues, such as lactating mammary gland, adrenal cortex, Sertoli and Leydig cells, and hepatocytes in alcoholic liver cirrhosis, suggesting that it may serve as a marker of lipid accumulation in diverse cell types and diseases. Alternatively spliced transcript variants have been found for this gene.

Immunogén

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 88-437 of human Perilipin-2 (NP_001113.2).

Alkalmazás

WB, IHC, IF/ICC

Biztonsági adatok

• Piktogramok: GHS07,GHS09
• Figyelmeztetés: Warning
• Figyelmeztető mondatok: H317,H411
• Óvintézkedésre vonatkozó mondatok: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Veszélyességi osztályok: Aquatic Chronic 2 - Skin Sens. 1
• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3