SAB2108842

Anti-POLQ (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Szinonimák: CP25, HHO.C8, HOX3, HOX3C
• UNSPSC kód: 12352203
• NACRES: NA.43

Tulajdonságok

• biológiai forrás: rabbit
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 180 kDa
• faj reaktivitás (homológia által előrejelzett): bovine, rabbit, rat, horse, mouse, canine, guinea pig, human
• koncentráció: 0.5 mg/mL
• technika/technikák: western blot: 1 μg/mL
• NCBI elérési szám: NM_199420.3
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... POLQ(57396)

Leírás

Általános leírás

POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Immunogen

Synthetic peptide directed towards the C terminal region of human POLQ

Szekvencia

Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL

Fizikai forma

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: nwg
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable