Ugrás a tartalomra
Merck
Összes fotó(3)

Fontos dokumentumok

SAB2104768

Sigma-Aldrich

Anti-MYH-1 Antibody

rabbit polyclonal

Szinonimák:

Anti-MGC133384, Anti-MYHSA1, Anti-MYHa, Anti-MyHC-2X/D

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
NACRES:
NA.41

product name

Anti-MYH1, (N-terminal) antibody produced in rabbit, affinity isolated antibody

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

form

buffered aqueous solution

molekulatömeg

223 kDa

faj reaktivitás

bovine, mouse, rat, horse, human, rabbit, sheep, guinea pig

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

western blot: suitable

NCBI elérési szám

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... MYH1(4619)

Immunogen

Synthetic peptide directed towards the N terminal region of human MYH1

Biokémiai/fiziológiai hatások

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin hea

Szekvencia

Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 3

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Tue L Nielsen et al.
Biomedicines, 10(2) (2022-02-26)
Muscular dystrophies constitute a broad group of genetic disorders leading to muscle wasting. We have previously demonstrated that treating a muscular atrophy mouse model with growth factors resulted in increased muscle mass. In the present study, we treated the Duchenne
Thomas O Krag et al.
Journal of neuropathology and experimental neurology, 75(5), 441-454 (2016-04-01)
McArdle disease (muscle glycogenosis type V) is caused by myophosphorylase deficiency, which leads to impaired glycogen breakdown. We investigated how myophosphorylase deficiency affects muscle physiology, morphology, and glucose metabolism in 20-week-old McArdle mice and compared the findings to those in
Guoliang Zhang et al.
Aging, 11(19), 8313-8328 (2019-10-03)
In this study, we used high-throughput RNA sequencing to identify mRNAs, long non-coding RNAs (lncRNAs) and circular RNAs (circRNAs) that are differentially expressed in the Substantia Nigra (SN) of aged and young rats. Gene Ontology and Kyoto Encyclopedia of Genes
Shirley Nieves-Rodriguez et al.
Frontiers in genetics, 14, 1216066-1216066 (2023-08-14)
Muscle damage and fibro-fatty replacement of skeletal muscles is a main pathologic feature of Duchenne muscular dystrophy (DMD) with more proximal muscles affected earlier and more distal affected later in the disease course, suggesting that different skeletal muscle groups possess
Charles A Stuart et al.
American journal of physiology. Cell physiology, 310(5), C381-C389 (2015-12-18)
Muscle fiber composition correlates with insulin resistance, and exercise training can increase slow-twitch (type I) fibers and, thereby, mitigate diabetes risk. Human skeletal muscle is made up of three distinct fiber types, but muscle contains many more isoforms of myosin

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással