MSST0060

SILu^™Lite CST3, Cystatin C human

recombinant, expressed in E. coli, MS Protein Standard

• Szinonimák: CST3, Cystatin C
• UNSPSC kód: 23201100
• NACRES: NA.32

Tulajdonságok

• rekombináns: expressed in E. coli
• Minőségi szint: 200
• Teszt: ≥95% (SDS-PAGE)
• Forma: lyophilized powder
• alkalmasság: suitable for mass spectrometry (internal calibrator)
• UniProt elérési szám: P01034 (aa 27-146)
• kiszállítva: ambient
• tárolási hőmérséklet: −20°C
• Géninformáció: human ... CST3(1471)

Leírás

Általános leírás

SILu^™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu^™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biokémiai/fiziológiai hatások

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Szekvencia

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Fizikai forma

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Jogi információk

SILu is a trademark of Sigma-Aldrich Co. LLC

Biztonsági adatok

• Tárolási osztály kódja: 11 - Combustible Solids
• WGK: WGK 2
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable