HPA045727
Anti-SDHD antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-PGL, Anti-PGL1, Anti-cybS, Anti-Succinate Dehydrogenase Complex, Subunit D, Integral Membrane Protein
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(4)
About This Item
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
faj reaktivitás
human
technika/technikák
immunohistochemistry: 1:20- 1:50
immunogén szekvencia
RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SDHD(6392)
Related Categories
Általános leírás
Succinate dehydrogenase complex subunit D (SDHD) gene encodes for a protein SDHD. It is a small sub unit of the cytochrome b, that is involved in the complex II of mitochondrial respiration. It is located at 11q23.1 on the human chromosome.
Immunogen
Succinate dehydrogenase complex subunit D recombinant protein epitope signature tag (PrEST)
Alkalmazás
Anti-SDHD antibody produced in rabbit has been used in immunohistochemistry.
Biokémiai/fiziológiai hatások
Mutation in this gene leads to paraganglioma and phaeochromocytoma.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST84465
Fizikai forma
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
In vivo detection of succinate by magnetic resonance spectroscopy as a hallmark of SDHx mutations in paraganglioma
Lussey L C, et al.
Clinical Cancer Research, 22(5), 1120-1129 (2016)
Risk assessment of maternally inherited SDHD paraganglioma and phaeochromocytoma
Burnichon N, et al.
Journal of medical Genetics, 54(2), 125-133 (2017)
Analysis of the SDHD gene, the susceptibility gene for familial paraganglioma syndrome (PGL1), in pheochromocytomas
Aguiar R C T, et al.
The Journal of Clinical Endocrinology and Metabolism, 86(6), 2890-2894 (2001)
Mélanie Menara et al.
The Journal of clinical endocrinology and metabolism, 100(2), E287-E291 (2014-11-19)
Pheochromocytomas (PCC) and paragangliomas (PGL) may be caused by a germline mutation in 12 different predisposing genes. We previously reported that immunohistochemistry is a useful approach to detect patients harboring SDHx mutations. SDHA immunostaining is negative in SDHA-mutated tumors only
Charlotte Lussey-Lepoutre et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 22(5), 1120-1129 (2015-10-23)
Germline mutations in genes encoding mitochondrial succinate dehydrogenase (SDH) are found in patients with paragangliomas, pheochromocytomas, gastrointestinal stromal tumors, and renal cancers. SDH inactivation leads to a massive accumulation of succinate, acting as an oncometabolite and which levels, assessed on
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással