HPA002868

Anti-SDHB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-SDH, Anti-SDH1
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA002868
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; IHC
• klón: polyclonal
• faj reaktivitás: rat, mouse, human
• citations: 58
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• faj reaktivitás: rat, mouse, human
• fejlettebb validálás: RNAi knockdown; Learn more about Antibody Enhanced Validation
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• immunogén szekvencia: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
• UniProt elérési szám: P21912
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... SDHB(6390)

Leírás

Általános leírás

Complex II (succinate-ubiquinone oxidoreductase) is a mitochondrial enzyme complex that regulates aerobic respiration and TCA cycle. It is the smallest mitochondrial respiratory chain complex and consists of four subunits, namely, SDHA, SDHB, SDHC, and SDHD. Germline mutations in SDHB have been associated with invasive paragangliomas and pheochromocytomas . Anti-SDHB antibody is specific for SDHB in humans.

Succinate dehydrogenase complex iron sulfur subunit B is a catalytic core subunit of a heterodimeric mitochondrial enzyme, succinate dehydrogenase (SDH). The hydrophilic SDHB subunit is exposed to the matrix side of the inner mitochondrial membrane. The SDHB gene, spanning 35.4 Kb, with eight exons, is located on human chromosome 1p36.13. The gene encodes for a 280 amino-acid protein.

Immunogén

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-SDHB antibody produced in rabbit has been used in western blotting and immunohistochemistry.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Biokémiai/fiziológiai hatások

Succinate dehydrogenase complex iron sulfur subunit B plays a key role in cellular metabolism and ATP synthesis by linking the biochemical reactions involved in oxidation of glucose to the mitochondrial electron transport chain. It is also responsible for the conversion of succinate to fumarate as part of the Kreb′s cycle. Germline mutations in the gene is associated with pheochromocytoma/paraganglioma syndrome, an autosomal dominant disorder.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST86628

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)