HPA029318
Anti-ASNS antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Asns Antibody, Asns Antibody - Anti-ASNS antibody produced in rabbit, Anti-asparagine synthetase
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(6)
About This Item
konjugátum:
unconjugated
application:
IHC
WB
WB
klón:
polyclonal
faj reaktivitás:
human
citations:
7
technika/technikák:
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
western blot: 0.04-0.4 μg/mL
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
human
fejlettebb validálás
independent
Learn more about Antibody Enhanced Validation
technika/technikák
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
immunogén szekvencia
QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... ASNS(440)
Általános leírás
The asparagine synthetase (ASNS) gene encodes for the enzyme L-asparaginase. The ASNS gene is located on the human chromosome at 7q21.3.
Immunogén
asparagine synthetase recombinant protein epitope signature tag (PrEST)
Alkalmazás
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ASNS antibody produced in rabbit has been used in immunohistochemistry (1:200). It has also been used in western blotting(1:250) (1:2000).
Biokémiai/fiziológiai hatások
L-Asparaginase facilitates the hydrolysis of L-asparagine to L-aspartic acid and ammonia. Mutations in the asparagine synthetase (ASNS) gene lead to asparagine synthetase deficiency, which is an autosomal recessive neurometabolic disorder. Mutations in this gene are also associated with microcephaly, characterized by a small-sized brain and head.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST70199
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Válasszon a legfrissebb verziók közül:
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Dorit Schleinitz et al.
Frontiers in genetics, 9, 245-245 (2018-07-31)
Microcephaly is a devastating condition defined by a small head and small brain compared to the age- and sex-matched population. Mutations in a number of different genes causative for microcephaly have been identified, e.g., MCPH1, WDR62, and ASPM. Recently, mutations
Lucas B Sullivan et al.
Nature cell biology, 20(7), 782-788 (2018-06-27)
Defining the metabolic limitations of tumour growth will help to develop cancer therapies1. Cancer cells proliferate slower in tumours than in standard culture conditions, indicating that a metabolic limitation may restrict cell proliferation in vivo. Aspartate synthesis can limit cancer
Simone Hettmer et al.
eLife, 4 (2015-10-27)
Current therapies for sarcomas are often inadequate. This study sought to identify actionable gene targets by selective targeting of the molecular networks that support sarcoma cell proliferation. Silencing of asparagine synthetase (ASNS), an amidotransferase that converts aspartate into asparagine, produced
Yong Fu et al.
Frontiers in oncology, 11, 637226-637226 (2021-03-30)
Dysregulated amino acids metabolism reciprocally interplays with evolutionary phenotypic characteristics of cancer cells to enhance metastasis. The high metastasis potential of oral squamous cell carcinoma (OSCC) can manifest with perineural invasion (PNI). We here aimed to determine the role of
Mohammed Zain Seidahmed et al.
BMC neurology, 16, 105-105 (2016-07-17)
Asparagine synthetase deficiency (OMIM# 615574) is a very rare newly described neurometabolic disorder characterized by congenital microcephaly and severe global developmental delay, associated with intractable seizures or hyperekplexia. Brain MRI typically shows cerebral atrophy with simplified gyral pattern and delayed
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással